![Western Blot: RNF135 Antibody [H00084282-D01P] - Analysis of RNF135 expression in human liver.](http://images.novusbio.com/fullsize/RNF135-Antibody-Western-Blot-H00084282-D01P-img0003.jpg "Western Blot: RNF135 Antibody [H00084282-D01P] - Analysis of RNF135 expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | RNF135 (NP_922921.1, 1 a.a. - 210 a.a.) full-length human protein. MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGLLSGPSIQPLT |
| Specificity | Reacts with ring finger protein 135. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RNF135 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RNF135 Antibody (H00084282-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RNF135 |
| Entrez |
|
| Uniprot |
|
![Western Blot: RNF135 Antibody [H00084282-D01P] - Analysis of RNF135 expression in transfected 293T cell line by RNF135 polyclonal antibody.Lane 1: RNF135 transfected lysate(22.90 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/RNF135-Antibody-Western-Blot-H00084282-D01P-img0004.jpg "Western Blot: RNF135 Antibody [H00084282-D01P] - Analysis of RNF135 expression in transfected 293T cell line by RNF135 polyclonal antibody.Lane 1: RNF135 transfected lysate(22.90 KDa).Lane 2: Non-transfected lysate.")
![Immunocytochemistry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Immunohistochemistry_19084.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14781.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14884.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")