RNF125 Antibody

Images

 
Immunohistochemistry-Paraffin: RNF125 Antibody [NBP1-83653] - Staining of human pancreas shows moderate cytoplasmic and nuclear positivity in exocrine pancreas.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF125 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF125
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNF125 Protein (NBP1-83653PEP)
Publications
Read Publication using
NBP1-83653 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF125 Antibody

  • E3 ubiquitin-protein ligase RNF125
  • EC 6.3.2.-
  • FLJ20456
  • MGC21737
  • ring finger protein 125TRAC1
  • T-cell RING activation protein 1
  • T-cell ring protein identified in activation screen
  • TRAC-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87204
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-04351
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81212
Species: Hu
Applications: WB, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83653
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RNF125 Antibody (NBP1-83653)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RNF125 Antibody (NBP1-83653) (0)

There are no reviews for RNF125 Antibody (NBP1-83653). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RNF125 Antibody (NBP1-83653) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF125 Products

Bioinformatics Tool for RNF125 Antibody (NBP1-83653)

Discover related pathways, diseases and genes to RNF125 Antibody (NBP1-83653). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF125 Antibody (NBP1-83653)

Discover more about diseases related to RNF125 Antibody (NBP1-83653).
 

Pathways for RNF125 Antibody (NBP1-83653)

View related products by pathway.

PTMs for RNF125 Antibody (NBP1-83653)

Learn more about PTMs related to RNF125 Antibody (NBP1-83653).
 

Research Areas for RNF125 Antibody (NBP1-83653)

Find related products by research area.

Blogs on RNF125

There are no specific blogs for RNF125, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF125 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF125