RNASET2 Antibody


Western Blot: RNASET2 Antibody [NBP1-88753] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: RNASET2 Antibody [NBP1-88753] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: RNASET2 Antibody [NBP1-88753] - Staining of human corpus, uterine shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

RNASET2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:FPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIP
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
RNASET2 Protein (NBP1-88753PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RNASET2 Antibody

  • EC 3.1.27.-
  • EC
  • FLJ10907
  • FLJ42372
  • Ribonuclease 6
  • ribonuclease T2
  • RNASE6PLbA514O12.3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RNASET2 Antibody (NBP1-88753) (0)

There are no publications for RNASET2 Antibody (NBP1-88753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNASET2 Antibody (NBP1-88753) (0)

There are no reviews for RNASET2 Antibody (NBP1-88753). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNASET2 Antibody (NBP1-88753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RNASET2 Antibody Products

Related Products by Gene

Bioinformatics Tool for RNASET2 Antibody (NBP1-88753)

Discover related pathways, diseases and genes to RNASET2 Antibody (NBP1-88753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNASET2 Antibody (NBP1-88753)

Discover more about diseases related to RNASET2 Antibody (NBP1-88753).

Pathways for RNASET2 Antibody (NBP1-88753)

View related products by pathway.

PTMs for RNASET2 Antibody (NBP1-88753)

Learn more about PTMs related to RNASET2 Antibody (NBP1-88753).

Blogs on RNASET2

There are no specific blogs for RNASET2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RNASET2 Antibody and receive a gift card or discount.


Gene Symbol RNASET2

Customers Who Bought This Also Bought