RNASET2 Antibody

Images

 
Western Blot: RNASET2 Antibody [NBP1-88753] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: RNASET2 Antibody [NBP1-88753] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: RNASET2 Antibody [NBP1-88753] - Staining of human corpus, uterine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

RNASET2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNASET2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
RNASET2 Protein (NBP1-88753PEP)

Alternate Names for RNASET2 Antibody

  • EC 3.1.27.-
  • EC 3.1.27.1
  • FLJ10907
  • FLJ42372
  • Ribonuclease 6
  • ribonuclease T2
  • RNASE6PLbA514O12.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000292-B01P
Species: Hu
Applications: WB, ELISA
NB120-2941
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
NBP1-69668
Species: Hu
Applications: WB
H00006196-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87804
Species: Hu
Applications: WB, IHC, IHC-P
H00003043-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF4210
Species: Hu
Applications: WB, IHC
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P

Publications for RNASET2 Antibody (NBP1-88753) (0)

There are no publications for RNASET2 Antibody (NBP1-88753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNASET2 Antibody (NBP1-88753) (0)

There are no reviews for RNASET2 Antibody (NBP1-88753). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNASET2 Antibody (NBP1-88753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNASET2 Antibody Products

Related Products by Gene

Bioinformatics Tool for RNASET2 Antibody (NBP1-88753)

Discover related pathways, diseases and genes to RNASET2 Antibody (NBP1-88753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNASET2 Antibody (NBP1-88753)

Discover more about diseases related to RNASET2 Antibody (NBP1-88753).
 

Pathways for RNASET2 Antibody (NBP1-88753)

View related products by pathway.

PTMs for RNASET2 Antibody (NBP1-88753)

Learn more about PTMs related to RNASET2 Antibody (NBP1-88753).

Blogs on RNASET2

There are no specific blogs for RNASET2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol RNASET2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-88753 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought