Recombinant Human RNase H1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RNase H1 Protein Summary

Description
RNase H1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: AACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
RNASEH1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNase H1 Protein

  • EC 3.1.26.4
  • H1RNA
  • Ribonuclease H type II
  • ribonuclease H1
  • RNase H1
  • RNH1

Background

RNASEH1 - ribonuclease H1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008852-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, IHC-FrFl
NB600-648
Species: Bv
Applications: WB, ELISA, IP
NBP1-91872
Species: Hu
Applications: IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-119
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
H00007150-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-351
Species: Hu, Ha, Pm, Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
H00246243-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RNase H1 Partial Recombinant Protein (H00246243-Q01) (0)

There are no publications for RNase H1 Partial Recombinant Protein (H00246243-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNase H1 Partial Recombinant Protein (H00246243-Q01) (0)

There are no reviews for RNase H1 Partial Recombinant Protein (H00246243-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNase H1 Partial Recombinant Protein (H00246243-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human RNase H1 Protein Products

Related Products by Gene

Bioinformatics Tool for RNase H1 Partial Recombinant Protein (H00246243-Q01)

Discover related pathways, diseases and genes to RNase H1 Partial Recombinant Protein (H00246243-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNase H1 Partial Recombinant Protein (H00246243-Q01)

Discover more about diseases related to RNase H1 Partial Recombinant Protein (H00246243-Q01).
 

Pathways for RNase H1 Partial Recombinant Protein (H00246243-Q01)

View related products by pathway.

PTMs for RNase H1 Partial Recombinant Protein (H00246243-Q01)

Learn more about PTMs related to RNase H1 Partial Recombinant Protein (H00246243-Q01).

Blogs on RNase H1

There are no specific blogs for RNase H1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNase H1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNASEH1

Customers Who Bought This Also Bought

53BP1 Antibody
NB100-304
53BP1 Antibody
NB100-304
53BP1 Antibody
NB100-304