RNA Polymerase II/POLR2A Recombinant Protein Antigen

Images

 
There are currently no images for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RNA Polymerase II/POLR2A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLR2A.

Source: E. coli

Amino Acid Sequence: IMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POLR2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87785. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RNA Polymerase II/POLR2A Recombinant Protein Antigen

  • DNA-directed RNA polymerase II largest subunit, RNA polymerase II 220 kdsubunit
  • DNA-directed RNA polymerase II subunit A
  • DNA-directed RNA polymerase II subunit RPB1
  • DNA-directed RNA polymerase III largest subunit
  • EC 2.7.7.48
  • EC 2.7.7.6
  • hRPB220
  • hsRPB1
  • MGC75453
  • POLR2
  • POLR2A
  • POLRA
  • polymerase (RNA) II (DNA directed) polypeptide A (220kD)
  • polymerase (RNA) II (DNA directed) polypeptide A, 220kDa
  • RNA Pol 2
  • RNA Polymerase 2
  • RNA polymerase II subunit B1
  • RNA Polymerase II
  • RNA-directed RNA polymerase II subunit RPB1
  • RNAPII
  • RPB1
  • RPBh1
  • RpIILS
  • RPO2
  • RPOL2

Background

RNA polymerase II (RNAPII) is an essential component of the RNAP II transcription elongation complex. Recruitment of RNA processing factors to the elongation complex is coordinated by the phosphorylation of Serine-2 and Serine-5 residues within the C-terminal repeat (YSPTSPS) domain of the largest subunit of RNAPII.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53092
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP1-80817
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-00482
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-80816
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, Simple Western, WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-92344
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP3-15345
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-513
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NB600-533
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP2-47329
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-93617
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB

Publications for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP) (0)

There are no publications for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP) (0)

There are no reviews for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNA Polymerase II/POLR2A Products

Research Areas for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP)

Find related products by research area.

Blogs on RNA Polymerase II/POLR2A

There are no specific blogs for RNA Polymerase II/POLR2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RNA Polymerase II/POLR2A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR2A