RNA Polymerase II/POLR2A Recombinant Protein Antigen

Images

 
There are currently no images for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RNA Polymerase II/POLR2A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLR2A.

Source: E.coli

Amino Acid Sequence: IMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYN

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POLR2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87785.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RNA Polymerase II/POLR2A Recombinant Protein Antigen

  • DNA-directed RNA polymerase II largest subunit, RNA polymerase II 220 kdsubunit
  • DNA-directed RNA polymerase II subunit A
  • DNA-directed RNA polymerase II subunit RPB1
  • DNA-directed RNA polymerase III largest subunit
  • EC 2.7.7.48
  • EC 2.7.7.6
  • hRPB220
  • hsRPB1
  • MGC75453
  • POLR2
  • POLR2A
  • POLRA
  • polymerase (RNA) II (DNA directed) polypeptide A (220kD)
  • polymerase (RNA) II (DNA directed) polypeptide A, 220kDa
  • RNA Pol 2
  • RNA Polymerase 2
  • RNA polymerase II subunit B1
  • RNA Polymerase II
  • RNA-directed RNA polymerase II subunit RPB1
  • RNAPII
  • RPB1
  • RPBh1
  • RpIILS
  • RPO2
  • RPOL2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87786
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19885
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Fe, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-80816
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67811
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-56713
Species: Hu
Applications: WB, ICC/IF
NB100-513
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00005478-M01
Species: Hu
Applications: WB, ELISA
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46733
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87785PEP
Species: Hu
Applications: AC

Publications for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP) (0)

There are no publications for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP) (0)

There are no reviews for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP)

Discover related pathways, diseases and genes to RNA Polymerase II/POLR2A Protein (NBP1-87785PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP)

Discover more about diseases related to RNA Polymerase II/POLR2A Protein (NBP1-87785PEP).
 

Pathways for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP)

View related products by pathway.

PTMs for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP)

Learn more about PTMs related to RNA Polymerase II/POLR2A Protein (NBP1-87785PEP).
 

Research Areas for RNA Polymerase II/POLR2A Protein (NBP1-87785PEP)

Find related products by research area.

Blogs on RNA Polymerase II/POLR2A

There are no specific blogs for RNA Polymerase II/POLR2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RNA Polymerase II/POLR2A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR2A