RKIP/PBP Antibody

Images

 
Western Blot: RKIP/PBP Antibody [NBP1-89711] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: RKIP/PBP Antibody [NBP1-89711] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RKIP/PBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RKIP/PBP Protein (NBP1-89711PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RKIP/PBP Antibody

  • HCNP
  • HCNPpp
  • hippocampal cholinergic neurostimulating peptide
  • Neuropolypeptide h3
  • PBP
  • PBPPEBP-1
  • PEBP1
  • PEBP-1
  • PEBPHCNPpp
  • phosphatidylethanolamine binding protein 1
  • phosphatidylethanolamine-binding protein 1
  • prostatic binding protein
  • Prostatic-binding protein
  • Raf kinase inhibitory protein
  • RKIP
  • RKIPRaf kinase inhibitor protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB4218
Species: Hu
Applications: WB, IHC
MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for RKIP/PBP Antibody (NBP1-89711) (0)

There are no publications for RKIP/PBP Antibody (NBP1-89711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RKIP/PBP Antibody (NBP1-89711) (0)

There are no reviews for RKIP/PBP Antibody (NBP1-89711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RKIP/PBP Antibody (NBP1-89711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RKIP/PBP Products

Bioinformatics Tool for RKIP/PBP Antibody (NBP1-89711)

Discover related pathways, diseases and genes to RKIP/PBP Antibody (NBP1-89711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RKIP/PBP Antibody (NBP1-89711)

Discover more about diseases related to RKIP/PBP Antibody (NBP1-89711).
 

Pathways for RKIP/PBP Antibody (NBP1-89711)

View related products by pathway.

PTMs for RKIP/PBP Antibody (NBP1-89711)

Learn more about PTMs related to RKIP/PBP Antibody (NBP1-89711).
 

Research Areas for RKIP/PBP Antibody (NBP1-89711)

Find related products by research area.

Blogs on RKIP/PBP

There are no specific blogs for RKIP/PBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RKIP/PBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEBP1
Entrez