RISC Antibody


Immunohistochemistry: RISC Antibody [NBP2-49250] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

RISC Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GTGFSYVNGSGAYAKDLAMVASDMMVLLKTFFSCHKEFQTVPFYIFSESYGGKMAAGIGLELYKAIQRGTIKC
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RISC Recombinant Protein Antigen (NBP2-49250PEP)

Reactivity Notes

Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RISC Antibody

  • EC 3.4.16
  • HSCP1
  • retinoid inducible serine carboxypeptidase
  • retinoid-inducible serine carboxypeptidase
  • RISCEC 3.4.16.-
  • SCP1
  • serine carboxypeptidase 1serine carboxypeptidase 1 precursor protein


Vascular smooth muscle activation is a salient feature of several pathological conditions including atherosclerosis, hypertension, vein graft failure, restenosis, and transplant arteriopathy (1,2). Several new genes whose proteins could lead to such biological effects have been identified. One such protein is RISC. Tissue expression pattern of Retinoid-inducible serine carboxypeptidase (RISC) in human revealed that it was highly expressed in kidney and heart.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Species: Eq, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IB, IP, KD, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB

Publications for RISC Antibody (NBP2-49250) (0)

There are no publications for RISC Antibody (NBP2-49250).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RISC Antibody (NBP2-49250) (0)

There are no reviews for RISC Antibody (NBP2-49250). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RISC Antibody (NBP2-49250) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RISC Products

Bioinformatics Tool for RISC Antibody (NBP2-49250)

Discover related pathways, diseases and genes to RISC Antibody (NBP2-49250). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RISC Antibody (NBP2-49250)

Discover more about diseases related to RISC Antibody (NBP2-49250).

Pathways for RISC Antibody (NBP2-49250)

View related products by pathway.

PTMs for RISC Antibody (NBP2-49250)

Learn more about PTMs related to RISC Antibody (NBP2-49250).

Blogs on RISC

There are no specific blogs for RISC, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RISC Antibody and receive a gift card or discount.


Gene Symbol SCPEP1