RISC Antibody

Images

 
Western Blot: RISC Antibody [NBP1-87127] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: RISC Antibody [NBP1-87127] - Staining of human cell line U-2 OS shows positivity in golgi apparatus.
Immunohistochemistry-Paraffin: RISC Antibody [NBP1-87127] - Staining of human kidney shows strong cytoplasmic positivity(granular pattern) in cells in tubules.
Western Blot: RISC Antibody [NBP1-87127] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RISC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KPVISIVDELLEAGINVTVYNGQLDLIVDTMGQEAWVRKLKWPELPKFSQLKWKALYSDPKSLETSAFVKSYKNLAFYWILKAGHMVPSDQGDMALKMMRLVTQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCPEP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RISC Protein (NBP1-87127PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RISC Antibody

  • EC 3.4.16
  • HSCP1
  • retinoid inducible serine carboxypeptidase
  • retinoid-inducible serine carboxypeptidase
  • RISCEC 3.4.16.-
  • SCP1
  • serine carboxypeptidase 1serine carboxypeptidase 1 precursor protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-24725
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-31913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-28751
Species: Hu, Mu
Applications: WB, IB, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32283
Species: Hu, Mu, Rt
Applications: WB
AF6548
Species: Hu, Mu
Applications: IHC
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76581
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-55940
Species: Hu
Applications: ICC/IF
NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready

Publications for RISC Antibody (NBP1-87127) (0)

There are no publications for RISC Antibody (NBP1-87127).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RISC Antibody (NBP1-87127) (0)

There are no reviews for RISC Antibody (NBP1-87127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RISC Antibody (NBP1-87127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RISC Products

Bioinformatics Tool for RISC Antibody (NBP1-87127)

Discover related pathways, diseases and genes to RISC Antibody (NBP1-87127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RISC Antibody (NBP1-87127)

Discover more about diseases related to RISC Antibody (NBP1-87127).
 

Pathways for RISC Antibody (NBP1-87127)

View related products by pathway.

PTMs for RISC Antibody (NBP1-87127)

Learn more about PTMs related to RISC Antibody (NBP1-87127).

Blogs on RISC

There are no specific blogs for RISC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RISC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCPEP1