![Immunohistochemistry-Paraffin: RIOK1 Antibody [NBP2-47301] - Analysis in human testis and pancreas tissues using NBP2-47301 antibody. Corresponding RIOK1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RIOK1-Antibody-Immunohistochemistry-Paraffin-NBP2-47301-img0010.jpg "Immunohistochemistry-Paraffin: RIOK1 Antibody [NBP2-47301] - Analysis in human testis and pancreas tissues using NBP2-47301 antibody. Corresponding RIOK1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DWDWDEGVGKLAKGYVWNGGSNPQANRQTSDSSSAKMSTPADKVLRKFENKINLDKLNVTDSVINKVTEKSRQKEADMYRIKD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RIOK1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RIOK1 Antibody (NBP2-47301)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RIOK1 |
![Immunocytochemistry/Immunofluorescence: RIOK1 Antibody [NBP2-47301] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli, nuclear speckles & cytosol.](http://images.novusbio.com/fullsize/RIOK1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47301-img0004.jpg "Immunocytochemistry/Immunofluorescence: RIOK1 Antibody [NBP2-47301] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli, nuclear speckles & cytosol.")
![Immunohistochemistry-Paraffin: RIOK1 Antibody [NBP2-47301] - Staining of human testis shows moderate cytoplasmic positivity in subset of cells in seminiferous ducts.](http://images.novusbio.com/fullsize/RIOK1-Antibody-Immunohistochemistry-Paraffin-NBP2-47301-img0009.jpg "Immunohistochemistry-Paraffin: RIOK1 Antibody [NBP2-47301] - Staining of human testis shows moderate cytoplasmic positivity in subset of cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: RIOK1 Antibody [NBP2-47301] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/RIOK1-Antibody-Immunohistochemistry-Paraffin-NBP2-47301-img0005.jpg "Immunohistochemistry-Paraffin: RIOK1 Antibody [NBP2-47301] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: RIOK1 Antibody [NBP2-47301] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/RIOK1-Antibody-Immunohistochemistry-Paraffin-NBP2-47301-img0008.jpg "Immunohistochemistry-Paraffin: RIOK1 Antibody [NBP2-47301] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")