RASGEF1A Antibody


Western Blot: RASGEF1A Antibody [NBP1-85670] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: RASGEF1A Antibody [NBP1-85670] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RASGEF1A Antibody [NBP1-85670] - Staining in human cerebral cortex and liver tissues using anti-RASGEF1A antibody. Corresponding RASGEF1A RNA-seq data are ...read more
Immunohistochemistry-Paraffin: RASGEF1A Antibody [NBP1-85670] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: RASGEF1A Antibody [NBP1-85670] - Staining of human liver shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

RASGEF1A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: HIELDRVSSIYPEDLMQIVSHMDSLDNHRCRGDLTKTYSLEAYDNWFNCLSMLVATEVCRVVKKKHRTRM
Specificity of human RASGEF1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RASGEF1A Protein (NBP1-85670PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RASGEF1A Antibody

  • CG4853 gene product
  • CG4853
  • FLJ37817
  • RasGEF domain family, member 1A
  • ras-GEF domain-containing family member 1A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for RASGEF1A Antibody (NBP1-85670) (0)

There are no publications for RASGEF1A Antibody (NBP1-85670).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASGEF1A Antibody (NBP1-85670) (0)

There are no reviews for RASGEF1A Antibody (NBP1-85670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RASGEF1A Antibody (NBP1-85670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RASGEF1A Products

Bioinformatics Tool for RASGEF1A Antibody (NBP1-85670)

Discover related pathways, diseases and genes to RASGEF1A Antibody (NBP1-85670). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASGEF1A Antibody (NBP1-85670)

Discover more about diseases related to RASGEF1A Antibody (NBP1-85670).

Pathways for RASGEF1A Antibody (NBP1-85670)

View related products by pathway.

Research Areas for RASGEF1A Antibody (NBP1-85670)

Find related products by research area.

Blogs on RASGEF1A

There are no specific blogs for RASGEF1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RASGEF1A Antibody and receive a gift card or discount.


Gene Symbol RASGEF1A