RIMS3 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human RIMS3. Peptide sequence: IMLDELDLSAAVTGWYKLFPTSSVADSTLGSLTRRLSQSSLESATSPSCS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RIMS3 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Protein A purified |
Alternate Names for RIMS3 Antibody - BSA Free
Background
Regulates synaptic membrane exocytosis
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP
Species: Mu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: WB, IHC
Publications for RIMS3 Antibody (NBP2-85639) (0)
There are no publications for RIMS3 Antibody (NBP2-85639).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RIMS3 Antibody (NBP2-85639) (0)
There are no reviews for RIMS3 Antibody (NBP2-85639).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RIMS3 Antibody (NBP2-85639) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RIMS3 Products
Research Areas for RIMS3 Antibody (NBP2-85639)
Find related products by research area.
|
Blogs on RIMS3