Home » RIG-I » RIG-I Proteins » RIG-I Recombinant Protein Antigen

RIG-I Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RIG-I Recombinant Protein Antigen (NBP2-55599PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

RIG-I Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RIG-I.

Source: E.coli

Amino Acid Sequence: NREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVK
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DDX58
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55599 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RIG-I Recombinant Protein Antigen

  • DDX58
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 58
  • DEAD box protein 58
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide
  • DKFZp686N19181
  • EC 3.6.4.13
  • FLJ13599
  • probable ATP-dependent RNA helicase DDX58
  • retinoic acid inducible gene I
  • Retinoic acid-inducible gene 1 protein
  • Retinoic acid-inducible gene I protein
  • RIG-1
  • RIGI
  • RIG-I
  • RIG-IDKFZp434J1111
  • RNA helicase RIG-I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MDA5 Antibody
NB110-1244
Immunohistochemistry-Paraffin: MDA5 Antibody [NB110-1244] - Staining in paraffin embedded Human Pancreas. Antibody at 10 ug/mL. Microwaved antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
(8 Publications)
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, PEP-ELISA
MAVS Antibody
NB100-80859
Western Blot: MAVS Antibody [NB100-80859] - Rat brain tissue lysate with VISA antibody at (A) 0.5, (B) 1 and (C) 2 ug/ml.
Immunocytochemistry/Immunofluorescence: MAVS Antibody [NB100-80859] - Mouse Brain cells with VISA antibody at 20 ug/ml.
Immunohistochemistry-Paraffin: MAVS Antibody [NB100-80859] - Staining of human brain, cortex tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
TLR3 Antibody
(40C1285.6)
NBP2-24875
Flow Cytometry: TLR3 Antibody (40C1285.6) [NBP2-24875] - Expression of TLR3 protein on epithelial cells. HNEC (A), Detroit-562 (B) and FaDu (C) were stained intracellularly with FITC-Abs against TLR3 (open histograms) or appropriate isotype control (shaded histograms) and analyzed by flow cytometry. Representative pictures from one out of three independent experiments are shown. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0098239), licensed under a CC-BY licence.
Western Blot: TLR3 Antibody (40C1285.6) [NBP2-24875] - All the cell lines displayed a strong expression of TLR3 protein. Cell lysates were electrophoresed and blotted to PVDF membrane, which was probed with TLR3-specific antibody. To confirm the immunoreactivity of the antibody, different positive controls were included. Beta-actin was served as loading control and was used to normalize expression levels between cells. Data are representative for analysis of >=2 independent experiments. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0060671) licensed under a CC-BY licence.
Flow Cytometry: TLR3 Antibody (40C1285.6) [NBP2-24875] - Expression of TLR3 in Fravel, L363, OPM1, RPMI8226, XG1, and NCI-H929 as determined by flow cytometry. HCMLs were stained using an intracellular staining protocol with TLR3 antibodies followed by relevant secondary fluorescent-conjugated antibodies. Filled histograms (purple) represent the isotype controls and the open histograms (red) indicate TLR3. Data are representative for analysis of >=2 independent experiments. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0060671) licensed under a CC-BY licence.
(76 Publications)
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, BA, B/N, Flow-IC
IRF3 Antibody
(SD2062)
NBP2-67741
Western Blot: IRF3 Antibody (SD2062) [NBP2-67741] - Analysis of IRF3 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature. Positive control: Lane 1: Jurkat cell lysateLane 2: Hela cell lysate
Immunocytochemistry/Immunofluorescence: IRF3 Antibody (SD2062) [NBP2-67741] - Staining IRF3 in PANC-1 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: IRF3 Antibody (SD2062) [NBP2-67741] - Analysis of paraffin-embedded mouse pancreas tissue using anti-IRF3 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
IFN-beta [Biotin]
42400-1
IFN-beta [Biotin]
(26 Publications)
Species: Mu
DHX58 Antibody
NBP1-85348
Western Blot: DHX58 Antibody [NBP1-85348] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-163
Immunohistochemistry-Paraffin: DHX58 Antibody [NBP1-85348] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
ISYNA1 Antibody
NBP2-47415
Western Blot: ISYNA1 Antibody [NBP2-47415] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line HEK 293
Immunocytochemistry/Immunofluorescence: ISYNA1 Antibody [NBP2-47415] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining of human placenta.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - Analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - IHC-P of rabbit aorta using NB100-56583. Secondary antibody: anti-mouse histofine ( Nisherei Bioscience Inc. ref: 414131F). Development: DAB (Dako ref: K346811-2) and counterstained with Hematoxylin. Submitted via verified customer review
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U937 cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(4 Publications)
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
IFN-alpha 1
Antibody
NBP2-75930
Western Blot: IFN-alpha 1 Antibody [NBP2-75930] - analysis of IFNA1 on mouse liver tissue lysate using anti-IFNA1 antibody at 1/100 dilution.
Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: IFN-alpha 1 Antibody [NBP2-75930] - analysis of paraffin-embedded mouse brain tissue tissue using anti-IFNA1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(645 Publications)
Species: Hu
TRIF/TICAM1
Antibody
NB120-13810
Western Blot: TRIF/TICAM1 Antibody [NB120-13810] - Analysis of TRIF in mouse spleen probed with TRIF antibody, in A: presence and B: absence of immunizing peptide, at 1:1000.
Immunocytochemistry/Immunofluorescence: TRIF/TICAM1 Antibody [NB120-13810] - TRIF antibody was tested in A431 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40X. An antibody dilution of 1:10 was used.
Western Blot: TRIF/TICAM1 Antibody [NB120-13810] - Analysis of TRIF in mouse A: Intestine. B: Spleen. C: RAW lysate using TRIF antibody at 1:1000 dilution.
(31 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
TLR7 Antibody
NBP2-24906
Immunohistochemistry: TLR7 Antibody [NBP2-24906] - The expression of TLR-7 in the hippocampal brain region. The immunofluorescence of TLR7 recognized by Alexa 488, green. GFAP recognized by Alexa 594, red. NEUN recognized by Alexa 633, (blue) and merged image in the hippocampal region. NeuN and GFAP were applied to show the distribution of TLR7 within neuronal and supportive tissue populations. Scale bar 80 um. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0222818) licensed under a CC-BY licence.
Flow Cytometry: TLR7 Antibody [NBP2-24906] - An intracellular stain was performed on THP-1 cells with NBP2-24906 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5.0 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.
Immunocytochemistry/Immunofluorescence: TLR7 Antibody [NBP2-24906] - Immunolocalization of TLR7 (A) and glial fibrillary acidic protein (GFAP) (B) in murine myenteric plexus. Most of the GFAP positive cells were also positive for TLR7 in the merged image (C, yellow staining). (Courtesy of Barajon I, et al., Journal of Histochemistry and Cytochemistry, 57(11): 1013-;1023, 2009.)
(4 Reviews)
(64 Publications)
Species: Hu, Mu, Rt
Applications: WB, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, BA, Flow-IC
TBK1 Antibody
(108A429)
NB100-56705
Western Blot: TBK1 Antibody (108A429) [NB100-56705] - Analysis using Azide and BSA Free version of NB100-56705. Lysate from 293 cells untransfected (lane 1) and transfected with human TBK1 cDNA (lane 2) probed with TBK1 antibody at 2 ug/ml.
Immunocytochemistry/Immunofluorescence: TBK1 Antibody (108A429) [NB100-56705] - Antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red). A dilution of 1:10 was used. Image objective 40x.
Immunohistochemistry-Paraffin: TBK1 Antibody (108A429) [NB100-56705] - Immunohistochemistry: TBK1 Antibody (108A429) - Azide and BSA Free [NBP2-33243] - Staining on human testis (Formalin-Fixed Paraffin-Embedded (FFPE)) Image from the Azide and BSA Free version of this antibody.
(1 Review)
(26 Publications)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
IL-6 [HRP]
D6050
(25 Reviews)
(463 Publications)
Species: Hu
IRF7 Antibody
(SC0617)
NBP2-67634
Western Blot: IRF7 Antibody (SC0617) [NBP2-67634] - Analysis of IRF7 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature. Positive control: Lane 1: Jurkat cell lysateLane 2: Raji cell lysate Lane 2: 293 cell lysate
Immunocytochemistry/Immunofluorescence: IRF7 Antibody (SC0617) [NBP2-67634] - Staining IRF7 in PC-12 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: IRF7 Antibody (SC0617) [NBP2-67634] - Analysis of paraffin-embedded mouse liver tissue using anti-IRF7 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt, Fi, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
RNF36 Antibody
NB100-1207
Western Blot: RNF36 Antibody [NB100-1207] - (0.5ug/ml) staining of Mouse Testis lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: RNF36 Antibody [NB100-1207] - Staining of paraffin embedded Human Cerebellum at dilution of 2.5ug/ml. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: RNF36 Antibody [NB100-1207] - (3.8ug/ml) staining of paraffin embedded Human Testis. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
PKR Antibody
NBP1-77266
Western Blot: PKR Antibody [NBP1-77266] - WB Validation of PKR in Human Cell Lines. Antibodies: PKR. Secondary: Goat anti-rabbit IgG HRP conjugate.
Immunohistochemistry-Paraffin: PKR Antibody [NBP1-77266] - Staining of mouse lung tissue with antibody at 5 ug/mL.
Western Blot: PKR Antibody [NBP1-77266] - IAV via Protein Expression Profile in Cell Lines. Antibodies PKR and beta-actin. Secondary: Goat anti-rabbit IgG HRP conjugate.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
CXCL10/IP-10/CRG-2
[HRP]
DIP100
(5 Reviews)
(103 Publications)
Species: Hu

Publications for RIG-I Recombinant Protein Antigen (NBP2-55599PEP) (0)

There are no publications for RIG-I Recombinant Protein Antigen (NBP2-55599PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIG-I Recombinant Protein Antigen (NBP2-55599PEP) (0)

There are no reviews for RIG-I Recombinant Protein Antigen (NBP2-55599PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RIG-I Recombinant Protein Antigen (NBP2-55599PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional RIG-I Products

Bioinformatics Tool for RIG-I Recombinant Protein Antigen (NBP2-55599PEP)

Discover related pathways, diseases and genes to RIG-I Recombinant Protein Antigen (NBP2-55599PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIG-I Recombinant Protein Antigen (NBP2-55599PEP)

Discover more about diseases related to RIG-I Recombinant Protein Antigen (NBP2-55599PEP).
 

Pathways for RIG-I Recombinant Protein Antigen (NBP2-55599PEP)

View related products by pathway.

PTMs for RIG-I Recombinant Protein Antigen (NBP2-55599PEP)

Learn more about PTMs related to RIG-I Recombinant Protein Antigen (NBP2-55599PEP).

Blogs on RIG-I

There are no specific blogs for RIG-I, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
IL-6 [HRP]
IL-6 [HRP]
D6050

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RIG-I Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DDX58