RIG-I Recombinant Protein Antigen

Images

 
There are currently no images for RIG-I Recombinant Protein Antigen (NBP2-55599PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RIG-I Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RIG-I.

Source: E. coli

Amino Acid Sequence: NREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RIGI
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55599.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RIG-I Recombinant Protein Antigen

  • DDX58
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 58
  • DEAD box protein 58
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide
  • DKFZp686N19181
  • EC 3.6.4.13
  • FLJ13599
  • probable ATP-dependent RNA helicase DDX58
  • retinoic acid inducible gene I
  • Retinoic acid-inducible gene 1 protein
  • Retinoic acid-inducible gene I protein
  • RIG-1
  • RIGI
  • RIG-I
  • RIG-IDKFZp434J1111
  • RNA helicase RIG-I

Background

RIG-I, also known as DDX58, consists of a 106.6 kDa and a 101.4 kDa isoform and is involved in recognizing viruses and activating a response. Current research is being conducted with diseases and disorders such as hepatitis, rubella, influenza, rabies, hemorrhagic fever, lupus nephritis, and tick-borne encephalitis. The protein interacts in pathways such as NF-kappa signaling, cytosolic DNA-sensing, measles, influenza A, and mediated induction pathways with proteins such as CYLD, ZC3HAV1, DDX3X, MAVS, and WRNIP1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-1244
Species: Hu, Mu, Pm
Applications: Flow, IHC,  IHC-P, PEP-ELISA
NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
8499-IF
Species: Hu
Applications: BA
NBP1-85348
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB120-13810
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-24906
Species: Hu, Mu, Rt
Applications: BA, DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, Simple Western, WB
NB100-56705
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-67634
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-1207
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-77266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DIP100
Species: Hu
Applications: ELISA

Publications for RIG-I Recombinant Protein Antigen (NBP2-55599PEP) (0)

There are no publications for RIG-I Recombinant Protein Antigen (NBP2-55599PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIG-I Recombinant Protein Antigen (NBP2-55599PEP) (0)

There are no reviews for RIG-I Recombinant Protein Antigen (NBP2-55599PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RIG-I Recombinant Protein Antigen (NBP2-55599PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RIG-I Products

Research Areas for RIG-I Recombinant Protein Antigen (NBP2-55599PEP)

Find related products by research area.

Blogs on RIG-I.

Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release
By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T...  Read full blog post.


  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RIG-I Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RIGI