Recombinant Human Rictor GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Rictor GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-98 of Human Rictor

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RICTOR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Rictor GST (N-Term) Protein

  • AVO3 homolog
  • AVO3
  • hAVO3
  • KIAA1999DKFZp686B11164
  • mAVO3
  • MGC39830
  • PIA
  • Pianissimo
  • rapamycin-insensitive companion of mTOR
  • Rictor
  • RPTOR independent companion of MTOR, complex 2
  • TORC2-specific protein AVO3

Background

RICTOR - TORC2-specific protein AVO3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76289
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-24837
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22356
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB110-40424
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-88937
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NB600-1049
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4004
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00253260-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Rictor Partial Recombinant Protein (H00253260-Q01) (0)

There are no publications for Rictor Partial Recombinant Protein (H00253260-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rictor Partial Recombinant Protein (H00253260-Q01) (0)

There are no reviews for Rictor Partial Recombinant Protein (H00253260-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rictor Partial Recombinant Protein (H00253260-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rictor Products

Bioinformatics Tool for Rictor Partial Recombinant Protein (H00253260-Q01)

Discover related pathways, diseases and genes to Rictor Partial Recombinant Protein (H00253260-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rictor Partial Recombinant Protein (H00253260-Q01)

Discover more about diseases related to Rictor Partial Recombinant Protein (H00253260-Q01).
 

Pathways for Rictor Partial Recombinant Protein (H00253260-Q01)

View related products by pathway.

PTMs for Rictor Partial Recombinant Protein (H00253260-Q01)

Learn more about PTMs related to Rictor Partial Recombinant Protein (H00253260-Q01).
 

Research Areas for Rictor Partial Recombinant Protein (H00253260-Q01)

Find related products by research area.

Blogs on Rictor.

mTOR - a central regulator of cell metabolism
The mammalian target of rapamycin (mTOR) signaling pathway allows cells to monitor environmental signals like nutrient availability and oxygen levels. mTOR is a phosphoinositide 3-kinase (PI3K)-related protein that assembles into large protein comp...  Read full blog post.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Rictor GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RICTOR