Ribosomal Protein S6/RPS6 Antibody - BSA Free

Western Blot: Ribosomal Protein S6/RPS6 Antibody [NBP1-87099] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: MOLT-4

Immunocytochemistry/Immunofluorescence: Ribosomal Protein S6/RPS6 Antibody [NBP1-87099] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & endoplasmic reticulum.

Immunohistochemistry-Paraffin: Ribosomal Protein S6/RPS6 Antibody [NBP1-87099] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ribosomal Protein S6/RPS6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ribosomal Protein S6/RPS6 Antibody - BSA Free (NBP1-87099) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSK
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPS6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Ribosomal Protein S6/RPS6 Protein (NBP1-87099PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ribosomal Protein S6/RPS6 Antibody - BSA Free

• Phosphoprotein NP33, 40S ribosomal protein S6
• pS6
• Ribosomal Protein S6
• RPS6
• S6

Background

RPS6, also known as Ribosomal Protein S6, is a 29kDa 249 amino acid protein. The primary function of RPS6 is to control cell growth during the selective translation of mRNA. Current research is being conducted on RPS6 due to its relationship tomyeloid leukemia, Kaposi's sarcoma, cutaneous t cell lymphoma, lymphangioleiomyomatosis, congestive heart failure and b-cell lymphomas. RPS6 has been linked to the pathogenesis, transport, cell growth and cell death pathways where it interacts with RPS2, RPS3, RPL11, RPL26 and RPL35.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPS6