Ribosomal Protein S6/RPS6 Antibody (4C7P4) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RPS6 (NP_001001.2). MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVP |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
RPS6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Immunocytochemistry/ Immunofluorescence 1:100 - 1:2000
- Western Blot 1:1000 - 1:2000
|
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.09% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Ribosomal Protein S6/RPS6 Antibody (4C7P4)
Background
RPS6, also known as Ribosomal Protein S6, is a 29kDa 249 amino acid protein. The primary function of RPS6 is to control cell growth during the selective translation of mRNA. Current research is being conducted on RPS6 due to its relationship tomyeloid leukemia, Kaposi's sarcoma, cutaneous t cell lymphoma, lymphangioleiomyomatosis, congestive heart failure and b-cell lymphomas. RPS6 has been linked to the pathogenesis, transport, cell growth and cell death pathways where it interacts with RPS2, RPS3, RPL11, RPL26 and RPL35.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Publications for Ribosomal Protein S6/RPS6 Antibody (NBP3-15435) (0)
There are no publications for Ribosomal Protein S6/RPS6 Antibody (NBP3-15435).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ribosomal Protein S6/RPS6 Antibody (NBP3-15435) (0)
There are no reviews for Ribosomal Protein S6/RPS6 Antibody (NBP3-15435).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Ribosomal Protein S6/RPS6 Antibody (NBP3-15435) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Ribosomal Protein S6/RPS6 Products
Research Areas for Ribosomal Protein S6/RPS6 Antibody (NBP3-15435)
Find related products by research area.
|
Blogs on Ribosomal Protein S6/RPS6