Ribonuclease A Antibody (1E5.)

Images

 
There are currently no images for Ribonuclease A Antibody (H00006035-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1E5.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Ribonuclease A Antibody (1E5.) Summary

Immunogen
RNASE1 (NP_002924.1, 29 a.a. - 128 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTS
Specificity
Reacts with ribonuclease, RNase A family, 1 (pancreatic).
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RNASE1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ribonuclease A Antibody (1E5.)

  • EC 3.1.27.5
  • HP-RNase
  • MGC12408
  • RIB1
  • RIB-1
  • Ribonuclease 1
  • Ribonuclease A
  • ribonuclease pancreatic
  • ribonuclease, RNase A family, 1 (pancreatic)
  • RNase A
  • RNase UpI-1
  • RNS1RNase 1

Background

This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03254
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-91872
Species: Hu
Applications: IHC, IHC-P
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-33778
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC

Publications for Ribonuclease A Antibody (H00006035-M01) (0)

There are no publications for Ribonuclease A Antibody (H00006035-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ribonuclease A Antibody (H00006035-M01) (0)

There are no reviews for Ribonuclease A Antibody (H00006035-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Ribonuclease A Antibody (H00006035-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ribonuclease A Products

Bioinformatics Tool for Ribonuclease A Antibody (H00006035-M01)

Discover related pathways, diseases and genes to Ribonuclease A Antibody (H00006035-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ribonuclease A Antibody (H00006035-M01)

Discover more about diseases related to Ribonuclease A Antibody (H00006035-M01).
 

Pathways for Ribonuclease A Antibody (H00006035-M01)

View related products by pathway.

PTMs for Ribonuclease A Antibody (H00006035-M01)

Learn more about PTMs related to Ribonuclease A Antibody (H00006035-M01).

Blogs on Ribonuclease A

There are no specific blogs for Ribonuclease A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ribonuclease A Antibody (1E5.) and receive a gift card or discount.

Bioinformatics

Gene Symbol RNASE1
Entrez
Uniprot