Rhot1 Antibody


Western Blot: Rhot1 Antibody [NBP1-59022] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Rhot1 Antibody [NBP1-59022] - Antibody Titration: 1 ug/ml HEK293.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Rhot1 Antibody Summary

Synthetic peptides corresponding to RHOT1(ras homolog gene family, member T1) The peptide sequence was selected from the middle region of RHOT1. Peptide sequence ASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RHOT1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Rhot1 Antibody

  • ARHT1
  • EC 3.6.5
  • EC 3.6.5.-
  • FLJ11040
  • FLJ12633
  • hMiro-1
  • Miro1
  • MIRO-1mitochondrial Rho GTPase 1
  • mitochondrial Rho 1
  • rac-GTP binding protein-like protein
  • Rac-GTP-binding protein-like protein
  • Ras homolog gene family member T1
  • ras homolog gene family, member T1
  • Rhot1


Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Rhot1 Antibody (NBP1-59022) (0)

There are no publications for Rhot1 Antibody (NBP1-59022).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rhot1 Antibody (NBP1-59022) (0)

There are no reviews for Rhot1 Antibody (NBP1-59022). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rhot1 Antibody (NBP1-59022) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Rhot1 Products

Bioinformatics Tool for Rhot1 Antibody (NBP1-59022)

Discover related pathways, diseases and genes to Rhot1 Antibody (NBP1-59022). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rhot1 Antibody (NBP1-59022)

Discover more about diseases related to Rhot1 Antibody (NBP1-59022).

Pathways for Rhot1 Antibody (NBP1-59022)

View related products by pathway.

PTMs for Rhot1 Antibody (NBP1-59022)

Learn more about PTMs related to Rhot1 Antibody (NBP1-59022).

Research Areas for Rhot1 Antibody (NBP1-59022)

Find related products by research area.

Blogs on Rhot1

There are no specific blogs for Rhot1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Rhot1 Antibody and receive a gift card or discount.


Gene Symbol RHOT1