Rhot1 Antibody

Images

 
Western Blot: Rhot1 Antibody [NBP1-59022] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Rhot1 Antibody [NBP1-59022] - Antibody Titration: 1 ug/ml HEK293.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

Rhot1 Antibody Summary

Immunogen
Synthetic peptides corresponding to RHOT1(ras homolog gene family, member T1) The peptide sequence was selected from the middle region of RHOT1. Peptide sequence ASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMR.
Clonality
Polyclonal
Host
Rabbit
Gene
RHOT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RHOT1 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Rhot1 Antibody

  • ARHT1
  • EC 3.6.5
  • EC 3.6.5.-
  • FLJ11040
  • FLJ12633
  • hMiro-1
  • Miro1/Rhot1
  • MIRO-1mitochondrial Rho GTPase 1
  • mitochondrial Rho 1
  • rac-GTP binding protein-like protein
  • Rac-GTP-binding protein-like protein
  • Ras homolog gene family member T1
  • ras homolog gene family, member T1
  • Rhot1

Background

Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88982
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90182
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-56761
Species: Hu
Applications: WB
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000292-B01P
Species: Hu
Applications: WB, ELISA
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-32509
Species: Hu
Applications: WB, IHC, IHC-P
MAB58551
Species: Hu
Applications: WB, IHC, ICFlow
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP1-71775
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-55290
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89142
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009804-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for Rhot1 Antibody (NBP1-59022) (0)

There are no publications for Rhot1 Antibody (NBP1-59022).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rhot1 Antibody (NBP1-59022) (0)

There are no reviews for Rhot1 Antibody (NBP1-59022). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rhot1 Antibody (NBP1-59022) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rhot1 Antibody Products

Related Products by Gene

Bioinformatics Tool for Rhot1 Antibody (NBP1-59022)

Discover related pathways, diseases and genes to Rhot1 Antibody (NBP1-59022). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rhot1 Antibody (NBP1-59022)

Discover more about diseases related to Rhot1 Antibody (NBP1-59022).
 

Pathways for Rhot1 Antibody (NBP1-59022)

View related products by pathway.

PTMs for Rhot1 Antibody (NBP1-59022)

Learn more about PTMs related to Rhot1 Antibody (NBP1-59022).
 

Research Areas for Rhot1 Antibody (NBP1-59022)

Find related products by research area.

Blogs on Rhot1

There are no specific blogs for Rhot1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol RHOT1
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59022 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought