Recombinant Human RhoJ Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RhoJ Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-214 of Human RHOJ full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RHOJ

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RhoJ Protein

  • ARHJTC10B
  • FLJ14445
  • ras homolog gene family, member J
  • RASL7B
  • Ras-like protein family member 7B
  • RAS-like, family 7, member B
  • RHOI
  • rho-related GTP-binding protein RhoJ
  • Tc10-like GTP-binding protein
  • TC10-like Rho GTPase
  • TCLMGC34777

Background

RHOJ( AAH62575, 1 a.a. - 215 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
H00023433-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-81657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
H00051804-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NBP1-82478
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP

Publications for RhoJ Recombinant Protein (H00057381-P01) (0)

There are no publications for RhoJ Recombinant Protein (H00057381-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoJ Recombinant Protein (H00057381-P01) (0)

There are no reviews for RhoJ Recombinant Protein (H00057381-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RhoJ Recombinant Protein (H00057381-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RhoJ Products

Bioinformatics Tool for RhoJ Recombinant Protein (H00057381-P01)

Discover related pathways, diseases and genes to RhoJ Recombinant Protein (H00057381-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RhoJ Recombinant Protein (H00057381-P01)

Discover more about diseases related to RhoJ Recombinant Protein (H00057381-P01).
 

Pathways for RhoJ Recombinant Protein (H00057381-P01)

View related products by pathway.

PTMs for RhoJ Recombinant Protein (H00057381-P01)

Learn more about PTMs related to RhoJ Recombinant Protein (H00057381-P01).
 

Research Areas for RhoJ Recombinant Protein (H00057381-P01)

Find related products by research area.

Blogs on RhoJ

There are no specific blogs for RhoJ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RhoJ Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOJ