Novus Biologicals products are now on bio-techne.com

Recombinant Human RhoJ GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human RhoJ GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-214 of Human RHOJ full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
RHOJ
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
49.28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RhoJ GST (N-Term) Protein

  • ARHJTC10B
  • FLJ14445
  • ras homolog gene family, member J
  • RASL7B
  • Ras-like protein family member 7B
  • RAS-like, family 7, member B
  • RHOI
  • rho-related GTP-binding protein RhoJ
  • Tc10-like GTP-binding protein
  • TC10-like Rho GTPase
  • TCLMGC34777

Background

RHOJ( AAH62575, 1 a.a. - 215 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87441
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP3-15915
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
DY393
Species: Hu
Applications: ELISA
H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
H00005997-M01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
NB100-314
Species: Hu
Applications: IP, WB
H00051804-M09
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP1-82478
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for RhoJ Recombinant Protein (H00057381-P01) (0)

There are no publications for RhoJ Recombinant Protein (H00057381-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoJ Recombinant Protein (H00057381-P01) (0)

There are no reviews for RhoJ Recombinant Protein (H00057381-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RhoJ Recombinant Protein (H00057381-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RhoJ Products

Research Areas for RhoJ Recombinant Protein (H00057381-P01)

Find related products by research area.

Blogs on RhoJ

There are no specific blogs for RhoJ, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RhoJ GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOJ