RHCG Antibody

Images

 
Immunohistochemistry: RHCG Antibody [NBP2-30825] - Staining of human oral mucosa shows strong membranous and cytoplasmic positivity in superficial squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHCG Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHCG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RHCG Protein (NBP2-30825PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RHCG Antibody

  • ammonium transporter Rh type C
  • CDRC2
  • chromosome 15 open reading frame 6
  • PDRC2C15orf6
  • Rh family type C glycoprotein
  • Rh family, C glycoprotein
  • Rh glycoprotein kidney
  • Rh type C glycoprotein
  • Rhesus blood group family type C glycoprotein
  • Rhesus blood group, C glycoprotein
  • RHGKTumor-related protein DRC2
  • SLC42A3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NBP2-59022
Species: Hu
Applications: WB, ICC/IF
NBP2-49180
Species: Hu
Applications: IHC
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01693
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP1-85064
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4218
Species: Hu
Applications: WB, IHC
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-30825
Species: Hu
Applications: IHC, IHC-P

Publications for RHCG Antibody (NBP2-30825) (0)

There are no publications for RHCG Antibody (NBP2-30825).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHCG Antibody (NBP2-30825) (0)

There are no reviews for RHCG Antibody (NBP2-30825). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RHCG Antibody (NBP2-30825) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHCG Products

Bioinformatics Tool for RHCG Antibody (NBP2-30825)

Discover related pathways, diseases and genes to RHCG Antibody (NBP2-30825). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHCG Antibody (NBP2-30825)

Discover more about diseases related to RHCG Antibody (NBP2-30825).
 

Pathways for RHCG Antibody (NBP2-30825)

View related products by pathway.

PTMs for RHCG Antibody (NBP2-30825)

Learn more about PTMs related to RHCG Antibody (NBP2-30825).

Blogs on RHCG

There are no specific blogs for RHCG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHCG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHCG
Uniprot