RHBDL3 Antibody

Images

 
Immunohistochemistry-Paraffin: RHBDL3 Antibody [NBP2-31783] - Staining of human bone marrow shows moderate cytoplasmic positivity in subset of hematopoietic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHBDL3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QFDPGNTGYISTGKFRSLLESHSSKLDPHKREVLLALADSHADGQIGYQDFVSLMSNKRSNS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHBDL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RHBDL3 Protein (NBP2-31783PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RHBDL3 Antibody

  • FLJ45582
  • MGC119300
  • MGC119301
  • RHBDL4
  • rhomboid, veinlet-like 3 (Drosophila)
  • rhomboid, veinlet-like 4
  • rhomboid-related protein 3
  • ventrhoid transmembrane protein
  • VRHO

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-188
Species: Rt
Applications: IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4184
Species: Hu, Mu
Applications: WB, IP, ICC
NB100-1319
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
NBP2-31783
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for RHBDL3 Antibody (NBP2-31783) (0)

There are no publications for RHBDL3 Antibody (NBP2-31783).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHBDL3 Antibody (NBP2-31783) (0)

There are no reviews for RHBDL3 Antibody (NBP2-31783). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RHBDL3 Antibody (NBP2-31783) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHBDL3 Products

Bioinformatics Tool for RHBDL3 Antibody (NBP2-31783)

Discover related pathways, diseases and genes to RHBDL3 Antibody (NBP2-31783). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHBDL3 Antibody (NBP2-31783)

Discover more about diseases related to RHBDL3 Antibody (NBP2-31783).

Blogs on RHBDL3

There are no specific blogs for RHBDL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHBDL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHBDL3
Uniprot