RHBDL3 Antibody - BSA Free

Immunohistochemistry-Paraffin: RHBDL3 Antibody [NBP2-31783] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neuropil.

Immunohistochemistry-Paraffin: RHBDL3 Antibody [NBP2-31783] - Staining of human fallopian tube shows strong positivity in plasma.

Immunohistochemistry-Paraffin: RHBDL3 Antibody [NBP2-31783] -Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: RHBDL3 Antibody [NBP2-31783] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Discontinued

RHBDL3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QFDPGNTGYISTGKFRSLLESHSSKLDPHKREVLLALADSHADGQIGYQDFVSLMSNKRSNS
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHBDL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RHBDL3 Antibody - BSA Free

• FLJ45582
• MGC119300
• MGC119301
• RHBDL4
• rhomboid, veinlet-like 3 (Drosophila)
• rhomboid, veinlet-like 4
• rhomboid-related protein 3
• ventrhoid transmembrane protein
• VRHO

Background

RHBDL3 may be involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptidesfrom their membrane anchors

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHBDL3
• Uniprot:
  • P58872(Human)