RHBDL1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLNKWVLQTYHPEYMKSPLVYHPGHRARAWRFLT |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RHBDL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for RHBDL1 Antibody - BSA Free
Background
RHBDL1, also known as Rhomboid-related protein 1 is a 48kDa 438 amino acid protein with a shorter 41kDa 373 isoform produced by alternative splicing. It is believed to play a role in regulating intramembrane proteolysis. Current research on RHBDL1 is being conducted in relation to leber hereditary optic neuropathy and neuropathy. RHBDL1 is known to interact with ZWINT.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Publications for RHBDL1 Antibody (NBP2-57513) (0)
There are no publications for RHBDL1 Antibody (NBP2-57513).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RHBDL1 Antibody (NBP2-57513) (0)
There are no reviews for RHBDL1 Antibody (NBP2-57513).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RHBDL1 Antibody (NBP2-57513) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RHBDL1 Products
Research Areas for RHBDL1 Antibody (NBP2-57513)
Find related products by research area.
|
Blogs on RHBDL1