RHBDL1 Antibody

Images

 
Immunohistochemistry-Paraffin: RHBDL1 Antibody [NBP2-13229] Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHBDL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ADTFTGLVHSHELPLDPAKLDMLVALAQSNEQGQVCYQELVDLISSKRSS SFKRAIANGQRALPRDGPLDEPGLGVYKRFVRY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHBDL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RHBDL1 Protein (NBP2-13229PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RHBDL1 Antibody

  • EC 3.4.21.105
  • RHBDLrhomboid, drosophila, homolog of
  • rhomboid, veinlet-like 1 (Drosophila)
  • Rhomboid-like protein 1
  • rhomboid-related protein 1
  • RRPrhomboid (veinlet, Drosophila)-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
MAB4675
Species: Mu
Applications: WB, IHC, Neut
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-34951
Species: Hu
NBP2-13229
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for RHBDL1 Antibody (NBP2-13229) (0)

There are no publications for RHBDL1 Antibody (NBP2-13229).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHBDL1 Antibody (NBP2-13229) (0)

There are no reviews for RHBDL1 Antibody (NBP2-13229). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RHBDL1 Antibody (NBP2-13229) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHBDL1 Products

Bioinformatics Tool for RHBDL1 Antibody (NBP2-13229)

Discover related pathways, diseases and genes to RHBDL1 Antibody (NBP2-13229). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RHBDL1

There are no specific blogs for RHBDL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHBDL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHBDL1