Recombinant Human RFWD3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RFWD3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 651-749 of Human RFWD3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DTGNPICSCQPVHTFFGGPTCKLLTKNAIFQSPENDGNILVCTGDEAANSALLWDAASGSLLQDLQTDQPVLDICPFEVNRNSYLATLTEKMVHTYKWE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RFWD3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RFWD3 Protein

  • EC 6.3.2.-
  • FLJ10520
  • ring finger and WD repeat domain 3
  • RING finger and WD repeat domain-containing protein 3
  • RING finger protein 201
  • RNF201E3 ubiquitin-protein ligase RFWD3

Background

RFWD3 - ring finger and WD repeat domain 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00084172-M10
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-23017
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB6798
Species: Hu
Applications: WB, ICC
H00055159-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RFWD3 Partial Recombinant Protein (H00055159-Q01) (0)

There are no publications for RFWD3 Partial Recombinant Protein (H00055159-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFWD3 Partial Recombinant Protein (H00055159-Q01) (0)

There are no reviews for RFWD3 Partial Recombinant Protein (H00055159-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFWD3 Partial Recombinant Protein (H00055159-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RFWD3 Products

Bioinformatics Tool for RFWD3 Partial Recombinant Protein (H00055159-Q01)

Discover related pathways, diseases and genes to RFWD3 Partial Recombinant Protein (H00055159-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFWD3 Partial Recombinant Protein (H00055159-Q01)

Discover more about diseases related to RFWD3 Partial Recombinant Protein (H00055159-Q01).
 

Pathways for RFWD3 Partial Recombinant Protein (H00055159-Q01)

View related products by pathway.

PTMs for RFWD3 Partial Recombinant Protein (H00055159-Q01)

Learn more about PTMs related to RFWD3 Partial Recombinant Protein (H00055159-Q01).
 

Research Areas for RFWD3 Partial Recombinant Protein (H00055159-Q01)

Find related products by research area.

Blogs on RFWD3

There are no specific blogs for RFWD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104
RFWD3 Antibody
NB100-68206

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RFWD3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RFWD3