RFPL1 Antibody

Images

 
Western Blot: RFPL1 Antibody [H00005988-B01P] - Analysis of RFPL1 expression in transfected 293T cell line by RFPL1 polyclonal antibody. Lane 1: RFPL1 transfected lysate(31.68 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RFPL1 Antibody Summary

Immunogen
RFPL1 (NP_066306.1, 1 a.a. - 288 a.a.) full-length human protein. MAALFQEASSCPVCSDYLEKPMSLECGCAVCFKCINSLQKEPHGEDLLCCCCSMVSQKNKIRPSWQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLISDDLRSVRSGCITQNRQDLAERFDVSICILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHRKGRIHLTTERGFWTVSLRDGSRLSASTVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICPVINPGTTDAPVHPGEAK
Specificity
RFPL1 - ret finger protein-like 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RFPL1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RFPL1 Antibody

  • MGC132428
  • ret finger protein-like 1
  • RFPL1L
  • RNF78RING finger protein 78

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38425
Species: Hu
Applications: IHC, IHC-P
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
H00064699-M01
Species: Hu
Applications: WB, ELISA
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-20042
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57109
Species: Hu
Applications: WB, ICC/IF
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02034
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-57626
Species: Hu
Applications: ICC/IF
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7178
Species: Hu
Applications: WB, Simple Western
NBP1-77120
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00388112-B01P
Species: Hu
Applications: WB, ELISA
NB100-56156
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for RFPL1 Antibody (H00005988-B01P) (0)

There are no publications for RFPL1 Antibody (H00005988-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFPL1 Antibody (H00005988-B01P) (0)

There are no reviews for RFPL1 Antibody (H00005988-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFPL1 Antibody (H00005988-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RFPL1 Products

Bioinformatics Tool for RFPL1 Antibody (H00005988-B01P)

Discover related pathways, diseases and genes to RFPL1 Antibody (H00005988-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFPL1 Antibody (H00005988-B01P)

Discover more about diseases related to RFPL1 Antibody (H00005988-B01P).
 

Pathways for RFPL1 Antibody (H00005988-B01P)

View related products by pathway.

Research Areas for RFPL1 Antibody (H00005988-B01P)

Find related products by research area.

Blogs on RFPL1

There are no specific blogs for RFPL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFPL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFPL1
Entrez
Uniprot