CAPZA3 Antibody

Immunohistochemistry-Paraffin: CAPZA3 Antibody [NBP2-38425] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: CAPZA3 Antibody [NBP2-38425] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: CAPZA3 Antibody [NBP2-38425] - Staining in human testis and endometrium tissues using anti-CAPZA3 antibody. Corresponding CAPZA3 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CAPZA3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFKYDLLQN
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAPZA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CAPZA3 Protein (NBP2-38425PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CAPZA3 Antibody

• CAPAA3
• CAPPA3F-actin capping protein alpha-3 subunit
• capping protein (actin filament) muscle Z-line, alpha 3
• CapZ alpha-3
• CP-alpha-3
• F-actin-capping protein subunit alpha-3
• Germ cell-specific protein 3
• Gsg3

Background

CAPZA3 encodes an actin capping protein, one of the F-actin capping protein alpha subunit family. The encoded protein is predominantly localized to the neck region of ejaculated sperm, other immunohistochemical signals were found in the tail and postacrosomal regions. The encoded protein may also form heterodimers of alpha and beta subunits. This protein may be important in determining sperm architecture and male fertility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAPZA3
• Uniprot:
  • Q96KX2(Human)