![Western Blot: RFK Antibody [NBP2-88141] - Host: Rabbit. Target Name: RFK. Sample Tissue: Human U937 Whole Cell lysates. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize2/RFK Antibody-Western Blot-NBP2-88141-img0001.jpg "Western Blot: RFK Antibody [NBP2-88141] - Host: Rabbit. Target Name: RFK. Sample Tissue: Human U937 Whole Cell lysates. Antibody Dilution: 1ug/ml")
| Reactivity | Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, Rb, Ye, ZeSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RFK. Peptide sequence: ASVGSGDVHKMVVSIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAIV The peptide sequence for this immunogen was taken from within the described region. |
| Predicted Species | Mouse (93%), Rat (93%), Porcine (100%), Rabbit (93%), Guinea Pig (93%), Bovine (100%), Zebrafish (100%), Canine (100%), Equine (100%), Yeast (100%). Backed by our 100% Guarantee. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RFK |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for RFK Antibody (NBP2-88141)Discover more about diseases related to RFK Antibody (NBP2-88141).
| Pathways for RFK Antibody (NBP2-88141)View related products by pathway.
|
PTMs for RFK Antibody (NBP2-88141)Learn more about PTMs related to RFK Antibody (NBP2-88141).
| Research Areas for RFK Antibody (NBP2-88141)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RFK |
![Western Blot: FLAD1 Antibody [NBP1-84752] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/images2/FLAD1-Antibody-Western-Blot-NBP1-84752-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: FLAD1 Antibody [NBP1-84752] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.](http://images.novusbio.com/images2/FLAD1 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84752-img0007.jpg)
![Immunohistochemistry-Paraffin: FLAD1 Antibody [NBP1-84752] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/FLAD1-Antibody-Immunohistochemistry-Paraffin-NBP1-84752-img0002.jpg)
![ELISA: FMN1 Antibody [44110002]](http://images.novusbio.com/images/44110002-T01565A01.jpg)
![Immunocytochemistry/Immunofluorescence: BRCA2 Antibody [NBP1-88361] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/BRCA2 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88361-img0011.jpg)
![Flow Cytometry: BRCA2 Antibody [NBP1-88361] - DNA damage induced by low-dose radiation and cfDNAox and cfDNAoxR fragments activates reparation of nuclear DNA. (a) (1) Flow cytometry detection of BRCA2 in irradiated (10cGy) and control cells stained with anti-BRCA2 antibodies and secondary FITC-conjugated antibodies. Gate R encircles the fraction of MSCs with elevated values of FL1- BRCA2; (2) distribution of cells with varying BRCA2 contents. Image collected and cropped by CiteAb from the following publication (hindawi.com/journals/omcl/2017/9515809/), licensed under a CC-BY licence.](http://images.novusbio.com/images2/BRCA2-Antibody-Flow-Cytometry-NBP1-88361-img0012.jpg)
![Knockdown Validated: FANCD2 Antibody [NB100-182] - Effects of FANCD2 knockdown on levels of cell cycle regulators. Caki-1 cells were transfected with control siRNA (siCon) or FANCD2 siRNA (siFD2#2) and treated with AICAR for 24 h. The levels of FANCD2, p15Ink4B, and p21Cip1 were evaluated by immunoblotting. Image collected and cropped by CiteAb from the following publication (http://doi.wiley.com/10.1002/2211-5463.12185) licensed under a CC-BY licence.](http://images.novusbio.com/images2/FANCD2-Antibody-Knockdown-Validated-NB100-182-img0040.jpg)
![Knockdown Validated: FANCD2 Antibody [NB100-182] - Resistance of FANCA-mutant cells with defective FANCD2 function to hydrogen peroxide (H2O2). Representative images illustrating staining for subnuclear FANCD2 foci in isogenic fibroblast pairs, either deficient for FANCD2 (PD20) or FANCA (PD220) and their respective wild-type (wt) complemented counterparts. Foci were visualized three hours after treatment with H2O2 (25 uM for 2 hours). Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/bmri/2008/821529/) licensed under a CC-BY licence.](http://images.novusbio.com/images2/FANCD2-Antibody-Knockdown-Validated-NB100-182-img0035.jpg)
![Western Blot: FANCD2 Antibody [NB100-182] - AMPK-activating AICAR treatment activates FANCD2, a pivotal molecule of Fanconi anemia DNA damage signaling pathway. AICAR treatment induces FANCD2 monoubiquitination in transformed normal fibroblasts (GM00637I). GM00637I cells were treated with 1 mm 2-deoxyglucose, 0.25 mM AICAR, or 1 mm phenformin for 24 h. Lysates were subjected to western blotting with FANCD2 Antibody, phospho-AMPKalpha1 (T172), and AMPKalpha and beta-actin. In FANCD2 blots, the position of monoubiquitinated FANCD2 (Ub-FANCD2) is indicated by an arrow. Image collected and cropped by CiteAb from the following publication (http://doi.wiley.com/10.1002/2211-5463.12185) licensed under a CC-BY licence.](http://images.novusbio.com/images2/FANCD2-Antibody-Western-Blot-NB100-182-img0039.jpg)
![Western Blot: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of THP-1 cell lysate.](http://images.novusbio.com/images2/Presenilin-1-Antibody-(APS-18)-Western-Blot-NB100-74510-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of Presenilin 1 using Presenilin 1 Monoclonal antibody (APS 18) shows staining in A2058 melanoma cells. Presenilin 1 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Presenilin 1 at a dilution of 1:20-1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.](http://images.novusbio.com/images2/Presenilin-1-Antibody-(APS-18)-Immunocytochemistry-Immunofluorescence-NB100-74510-img0022.jpg)
![Immunohistochemistry-Paraffin: Presenilin-1 Antibody (APS 18) [NB100-74510] - Normal biopsies of deparaffinized Human liver tissue.](http://images.novusbio.com/images2/Presenilin-1-Antibody-(APS-18)-Immunohistochemistry-Paraffin-NB100-74510-img0024.jpg)
![Thrombospondin-1 [HRP]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Thrombospondin-1 [HRP]")
![Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining in human adrenal gland and liver tissues using anti-QPCT antibody. Corresponding QPCT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Immunohistochemistry-Paraffin-NBP1-81838-img0010.jpg)
![Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in control (vector only transfected HEK293T lysate) and QPCT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Western-Blot-NBP1-81838-img0011.jpg)
![Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Western-Blot-NBP1-81838-img0006.jpg)
![Western Blot: Glutathione Reductase Antibody [NBP2-16684] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Glutathione Reductase antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/images2/Glutathione-Reductase-Antibody-Western-Blot-NBP2-16684-img0011.jpg)
![Immunohistochemistry-Paraffin: Glutathione Reductase Antibody [NBP2-16684] - Paraffin-embedded rat brain. Glutathione reductase antibody [N2C2], Internal diluted at 1:500.](http://images.novusbio.com/images2/Glutathione-Reductase-Antibody-Immunohistochemistry-Paraffin-NBP2-16684-img0005.jpg)
![Western Blot: Glutathione Reductase Antibody [NBP2-16684] - Sample (30 ug of whole cell lysate) A: HCT116 7. 5% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/Glutathione Reductase Antibody-Western Blot-NBP2-16684-img0001.jpg)
![Western Blot: SLC25A1 Antibody [NBP1-31851] - Whole cell extract (30 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with SLC25A1 antibody [N1C1] diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/images2/SLC25A1-Antibody-Western-Blot-NBP1-31851-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: SLC25A1 Antibody [NBP1-31851] - HepG2 cells were fixed in ice-cold MeOH for 5 min. Green: SLC25A1 protein stained by SLC25A1 antibody [N1C1] diluted at 1:500. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/SLC25A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31851-img0008.jpg)
![Western Blot: SLC25A1 Antibody [NBP1-31851] - Rat tissue extract (30 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with SLC25A1 antibody [N1C1] diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/images2/SLC25A1-Antibody-Western-Blot-NBP1-31851-img0002.jpg)
![Western Blot: NOX1 Antibody [NBP1-31546] - Representative Western blots showing Nox1 and beta-tubulin in PC-3 cells or Nox4 and beta-tubulin in C2C12 cells, at 5% and 18% O2. Total cellular proteins were extracted by treating cells with NP-40 buffer (150mM NaCl, 1% NP-40, 50mM Tris-HCl pH8.0). Total protein (15ug per sample) was resolved on 10% SDS-PAGE, transferred to a polyvinylidene difluoride membrane, and probed for Nox1 or Nox4. beta-Tubulin was used as an internal loading and transfer control. All antibodies were purchased from Novus Biologicals; Nox1 (NBP1-31546), Nox4 (NB110-58851), b-tubulin (NB600-936). Data were analysed using two-tailed Student's t-tests. Bars represent means+/-SEM from at least five independent experiments. p<0.05. The identities of bands at intermediate molecular weight are unknown. Image collected and cropped by CiteAb from the following publication (hindawi.com/journals/omcl/2018/8238459/), licensed under a CC-BY licence.](http://images.novusbio.com/images2/NOX1-Antibody-Western-Blot-NBP1-31546-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: NOX1 Antibody [NBP1-31546] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-NOX1 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/images2/NOX1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31546-img0007.jpg)
![Immunohistochemistry-Paraffin: NOX1 Antibody [NBP1-31546] - Human lung carcinoma. NOX1 antibody diluted at 1:500.](http://images.novusbio.com/images2/NOX1-Antibody-Immunohistochemistry-Paraffin-NBP1-31546-img0005.jpg)
![Western Blot: TRAIL R1/TNFRSF10A Antibody (32A1380) [NB100-56747] - Analysis of DR4 in Daudi cell lysate using DR4 antibody at 2 ug/ml. Goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/images2/TRAIL-R1-TNFRSF10A-Antibody-(32A1380)-Western-Blot-NB100-56747-img0002.jpg)
![Simple Western: TRAIL R1/TNFRSF10A Antibody (32A1380) [NB100-56747] - Simple Western lane view shows a specific band for TRAIL R1 in 0.5 mg/ml of Daudi lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody](http://images.novusbio.com/images2/TRAIL-R1-TNFRSF10A-Antibody-(32A1380)-Simple-Western-NB100-56747-img0003.jpg)
![Western Blot: GAPDH Antibody (1D4) [NB300-221] - analysis of GAPDH in human nucleus pulposus cell culture (40ug/lane) using anti-GAPDH antibody. LI-COR Odyssey imaging system was used for detection. Western blot image submitted by a verified customer review.](http://images.novusbio.com/images2/GAPDH-Antibody-(1D4)-Western-Blot-NB300-221-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - Analysis of of HeLa cells stained with GAPDH antibody, dilution 1:100 (Green). DAPI staining of nuclear DNA (Blue). The GAPDHantibody produces strong cytoplasmic staining of healthy cells.](http://images.novusbio.com/images2/GAPDH-Antibody-(1D4)-Immunocytochemistry-Immunofluorescence-NB300-221-img0009.jpg)
![Western Blot: GAPDH Antibody (1D4) [NB300-221] - Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.](http://images.novusbio.com/images2/GAPDH-Antibody-(1D4)-Western-Blot-NB300-221-img0008.jpg)
![Western Blot: TRAF-2 Antibody [NB100-56173] - Analysis of TRAF-2 in normal human tissues using this antibody. TRAF-2 is observed at ~60-64 kDa. Additional bands of lower molecular weight were seen in some cases, and may represent TRAF-2 degradation fragments.](http://images.novusbio.com/images2/TRAF-2-Antibody-Western-Blot-NB100-56173-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: TRAF-2 Antibody [NB100-56173] - Immunostaining of HN30 and MCF-12a cells for TRAF2 3 days post-transfectionMCF-12a NT (DAPI): non-treated MCF-12a DAPI stained, MCF-12a NT (TRAF2-FITC): non-treated MCF-12a FITC stained for TRAF2, MCF-12a pNSP 5a3a (DAPI): MCF-12a transfected with pcDNA 3.0 NSP 5a3a DAPI stained, MCF-12a pNSP 5a3a (TRAF2-FITC): MCF-12a transfected with pcDNA 3.0 NSP 5a3a FITC stained for Traf-2, HN30 NT (DAPI): non-treated HN30 DAPI stained, HN30 NT (TRAF2-FITC): non-treated HN30 FITC stained for TRAF2, HN30 pNSP 5a3a (DAPI): HN30 transfected with pcDNA 3.0 NSP 5a3a DAPI stained, HN30 pNSP 5a3a (TRAF2-FITC): HN30 transfected with pcDNA 3.0 NSP 5a3a FITC stained for TRAF2. White arrows indicate apoptotic bodies. Image collected and cropped by Cite Ab from the following publication (A novel dual signaling axis for NSP 5a3a induced apoptosis in head and neck carcinoma. Oncotarget (2011) licensed under a CC-BY licence.](http://images.novusbio.com/images2/TRAF-2 Antibody-Immunocytochemistry-Immunofluorescence-NB100-56173-img0009.jpg)
![Immunohistochemistry-Paraffin: TRAF-2 Antibody [NB100-56173] - Formalin-fixed, paraffin-embedded human colon carcinoma tissue sections stained for TRAF2 using this antibody at 1:2000. Hematoxylin-eosin counterstain.](http://images.novusbio.com/images2/TRAF-2-Antibody-Immunohistochemistry-Paraffin-NB100-56173-img0007.jpg)
![Sandwich ELISA: WDR36 Antibody (1D6) [H00134430-M01] - Detection limit for recombinant GST tagged WDR36 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/images2/WDR36 Antibody (1D6)-Sandwich ELISA-H00134430-M01-img0002.jpg)
![Western Blot: DCTN3 Antibody [NBP2-98673] - Anti-DCTN3 rabbit polyclonal antibody at 1:500 dilution. Lane A: 293T Whole Cell Lysate Lane B: HeLa Whole Cell Lysate Lane C: U-251 MG Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 21 kDa. Observed band size: 21 kDa](http://images.novusbio.com/images2/DCTN3-Antibody-Western-Blot-NBP2-98673-img0002.jpg)
![Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP2-98673] - Immunochemical staining of human DCTN3 in human pancreas with rabbit polyclonal antibody at 1:100 dilution, formalin-fixed paraffin embedded sections.](http://images.novusbio.com/images2/DCTN3-Antibody-Immunohistochemistry-Paraffin-NBP2-98673-img0003.jpg)
![Immunoprecipitation: DCTN3 Antibody [NBP2-98673] - DCTN3 was immunoprecipitated using: Lane A: 0.5 mg HeLa Whole Cell Lysate 4 ul anti-DCTN3 rabbit polyclonal antibody and 60 ug of Immunomagnetic beads Protein A/G. Primary antibody: Anti-DCTN3 rabbit polyclonal antibody, at 1:100 dilution. Secondary antibody: Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 21 kDa. Observed band size: 21 kDa](http://images.novusbio.com/images2/DCTN3-Antibody-Immunoprecipitation-NBP2-98673-img0001.jpg)
![Western Blot: Calcium-binding-protein-P22 Antibody [NBP1-33736] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE](http://images.novusbio.com/images2/Calcium-binding-protein-P22-Antibody-Western-Blot-NBP1-33736-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/Calcium-binding-protein-P22-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-33736-img0009.jpg)
![Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.](http://images.novusbio.com/images2/Calcium-binding-protein-P22-Antibody-Immunohistochemistry-Paraffin-NBP1-33736-img0007.jpg)
![Western Blot: BTG1 Antibody (4C10) [NBP2-46587] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY BTG 1.](http://images.novusbio.com/images2/BTG1 Antibody (4C10)-Western Blot-NBP2-46587-img0006.jpg)
![Immunohistochemistry: BTG1 Antibody (4C10) [NBP2-46587] - Analysis of Adenocarcinoma of Human endometrium tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/BTG1-Antibody-(4C10)-Immunohistochemistry-NBP2-46587-img0005.jpg)
![Immunohistochemistry: BTG1 Antibody (4C10) [NBP2-46587] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)](http://images.novusbio.com/images2/BTG1-Antibody-(4C10)-Immunohistochemistry-NBP2-46587-img0001.jpg)