RFK Antibody

Images

 
Western Blot: RFK Antibody [NBP2-88141] - Host: Rabbit. Target Name: RFK. Sample Tissue: Human U937 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, Rb, Ye, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RFK Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RFK. Peptide sequence: ASVGSGDVHKMVVSIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAIV The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (93%), Porcine (100%), Rabbit (93%), Guinea Pig (93%), Bovine (100%), Zebrafish (100%), Canine (100%), Equine (100%), Yeast (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
RFK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RFK Antibody

  • ATP:riboflavin 5'-phosphotransferase
  • EC 2.7.1.26
  • Flavokinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84752
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NB100-182
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-31546
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56747
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, CyTOF-ready, Flow-CS, Flow-IC
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
NB100-56173
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00134430-M01
Species: Hu, Rt, Ch, Pm
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-98673
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46587
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for RFK Antibody (NBP2-88141) (0)

There are no publications for RFK Antibody (NBP2-88141).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFK Antibody (NBP2-88141) (0)

There are no reviews for RFK Antibody (NBP2-88141). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFK Antibody (NBP2-88141) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RFK Products

Bioinformatics Tool for RFK Antibody (NBP2-88141)

Discover related pathways, diseases and genes to RFK Antibody (NBP2-88141). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFK Antibody (NBP2-88141)

Discover more about diseases related to RFK Antibody (NBP2-88141).
 

Pathways for RFK Antibody (NBP2-88141)

View related products by pathway.

PTMs for RFK Antibody (NBP2-88141)

Learn more about PTMs related to RFK Antibody (NBP2-88141).
 

Research Areas for RFK Antibody (NBP2-88141)

Find related products by research area.

Blogs on RFK

There are no specific blogs for RFK, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFK