Rffl Recombinant Protein Antigen

Images

 
There are currently no images for Rffl Protein (NBP1-83427PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Rffl Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RFFL.

Source: E.coli

Amino Acid Sequence: MKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVISQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSSS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RFFL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83427.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Rffl Recombinant Protein Antigen

  • CARP-2
  • Caspase regulator CARP2
  • Caspases-8 and -10-associated RING finger protein 2
  • E3 ubiquitin-protein ligase rififylin
  • EC 6.3.2
  • EC 6.3.2.-
  • Fring
  • FYVE-RING finger protein Sakura
  • rififylin
  • ring finger and FYVE-like domain containing 1
  • RING finger and FYVE-like domain-containing protein 1
  • RING finger protein 189
  • RING finger protein 34-like
  • RNF189CARP2
  • RNF34LFRING

Background

RFFL, also known as Rififylin, RING finger and FYVE-like domain-containing protein 1, FYVE-RING finger protein, Sakura, Fring, Caspases-8 and -10-associated RING finger protein 2, CARP-2, Caspase regulator CARP2, RING finger protein 189 and RING finger protein 34-like, is a novel modulator of NF-kB activation. RFFL possesses E3 ubiquitin protein ligase activity and has been shown to regulate the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. RFFL also possesses anti-apoptotic activity and may bind phosphatidylinositol phosphates. RFFL is a membrane bound cytoplasmic protein that is expressed ubiquitously. RFFL can be detected in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes and is rapidly degraded after stimulation with TNFSF10, and probably by caspases. Multiple transcript variants have been detected for this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

210-TA
Species: Hu
Applications: BA
NBP2-56413
Species: Hu
Applications: ICC/IF, IP, WB
NB500-186
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBL1-08611
Species: Hu
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00056287-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-98549
Species: Hu
Applications: WB
NBP1-76568
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
375-TL
Species: Hu
Applications: BA
DRT100
Species: Hu
Applications: ELISA
AF2187
Species: Hu, Mu
Applications: IP, Simple Western, WB
2914-HT
Species: Hu
Applications: BA
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
NBP2-22356
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP2-83997
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-83427PEP
Species: Hu
Applications: AC

Publications for Rffl Protein (NBP1-83427PEP) (0)

There are no publications for Rffl Protein (NBP1-83427PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rffl Protein (NBP1-83427PEP) (0)

There are no reviews for Rffl Protein (NBP1-83427PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rffl Protein (NBP1-83427PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rffl Products

Bioinformatics Tool for Rffl Protein (NBP1-83427PEP)

Discover related pathways, diseases and genes to Rffl Protein (NBP1-83427PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rffl Protein (NBP1-83427PEP)

Discover more about diseases related to Rffl Protein (NBP1-83427PEP).
 

Pathways for Rffl Protein (NBP1-83427PEP)

View related products by pathway.

PTMs for Rffl Protein (NBP1-83427PEP)

Learn more about PTMs related to Rffl Protein (NBP1-83427PEP).

Blogs on Rffl

There are no specific blogs for Rffl, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rffl Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RFFL