REXO4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: REXO4 Antibody [NBP2-13221] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli & nuclear speckles.
Immunohistochemistry-Paraffin: REXO4 Antibody [NBP2-13221] - Staining of human testis shows moderate nuclear/nucleolar positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

REXO4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGK DQEASRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKERTNGDIVPERGD IEHKKRKAKEAAPAPPTEEDIWFDDVDP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
REXO4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
REXO4 Protein (NBP2-13221PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for REXO4 Antibody

  • EC 3.1
  • Exonuclease XPMC2
  • hPMC2
  • PMC2
  • Prevents mitotic catastrophe 2 protein homolog
  • REX4, RNA exonuclease 4 homolog (S. cerevisiae)
  • RNA exonuclease 4
  • Xenopus prevents mitotic catastrophe 2 homolog
  • Xenopus prevents mitotic catatrophe 2 homolog
  • XPMC2 prevents mitotic catastrophe 2 homolog (Xenopus laevis)
  • XPMC2 prevents mitotic catastrophe 2 homolog
  • XPMC2
  • XPMC2HREX4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5089
Species: Hu
Applications: WB, IHC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for REXO4 Antibody (NBP2-13221) (0)

There are no publications for REXO4 Antibody (NBP2-13221).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REXO4 Antibody (NBP2-13221) (0)

There are no reviews for REXO4 Antibody (NBP2-13221). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for REXO4 Antibody (NBP2-13221) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional REXO4 Products

Bioinformatics Tool for REXO4 Antibody (NBP2-13221)

Discover related pathways, diseases and genes to REXO4 Antibody (NBP2-13221). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on REXO4

There are no specific blogs for REXO4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our REXO4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol REXO4