Retinol Binding Protein RBP Antibody

Images

 
Western Blot: Retinol Binding Protein RBP Antibody [NBP1-57677] - HCT116 cell lysate, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Retinol Binding Protein RBP Antibody Summary

Immunogen
Synthetic peptides corresponding to RBP1(retinol binding protein 1, cellular) The peptide sequence was selected from the middle region of RBP1. Peptide sequence IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RBP1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Retinol Binding Protein RBP Antibody

  • C
  • Cellular retinol-binding protein
  • CRABP-I
  • CRBP1CRBP-I
  • CRBPCellular retinol-binding protein I
  • CRBPI
  • RBPC
  • retinol binding protein 1, cellular
  • retinol-binding protein 1
  • retinol-binding protein 1, cellular

Background

RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision.RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. The gene harbors four exons encoding 24, 59, 33, and 16 amino acid residues respectively. The second intervening sequence alone occupies 19 kb of the 21 kb of the gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NB110-40499
Species: Hu, Mu
Applications: WB, IP
NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-81776
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-58922
Species: Hu
Applications: WB
NBP2-50444
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-47314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90232
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-32431
Species: Hu
Applications: IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74392
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-57677
Species: Hu
Applications: WB

Publications for Retinol Binding Protein RBP Antibody (NBP1-57677) (0)

There are no publications for Retinol Binding Protein RBP Antibody (NBP1-57677).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Retinol Binding Protein RBP Antibody (NBP1-57677) (0)

There are no reviews for Retinol Binding Protein RBP Antibody (NBP1-57677). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Retinol Binding Protein RBP Antibody (NBP1-57677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Retinol Binding Protein RBP Products

Bioinformatics Tool for Retinol Binding Protein RBP Antibody (NBP1-57677)

Discover related pathways, diseases and genes to Retinol Binding Protein RBP Antibody (NBP1-57677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Retinol Binding Protein RBP Antibody (NBP1-57677)

Discover more about diseases related to Retinol Binding Protein RBP Antibody (NBP1-57677).
 

Pathways for Retinol Binding Protein RBP Antibody (NBP1-57677)

View related products by pathway.

PTMs for Retinol Binding Protein RBP Antibody (NBP1-57677)

Learn more about PTMs related to Retinol Binding Protein RBP Antibody (NBP1-57677).

Blogs on Retinol Binding Protein RBP

There are no specific blogs for Retinol Binding Protein RBP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Retinol Binding Protein RBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBP1
Uniprot