REPIN1 Antibody - BSA Free

Western Blot: REPIN1 Antibody [NBP2-85621] - WB Suggested Anti-REPIN1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HT1080 cell lysateREPIN1 is supported by BioGPS gene expression data to be expressed in HT1080

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

REPIN1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit REPIN1 Antibody - BSA Free (NBP2-85621) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human REPIN1. Peptide sequence: VSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: REPIN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for REPIN1 Antibody - BSA Free

• 60 kDa origin-specific DNA-binding protein
• 60 kDa replication initiation region protein
• ATT-binding protein
• DHFR oribeta-binding protein RIP60
• H_DJ0584D14.12
• replication initiation region protein (60kD)
• replication initiator 1
• RIP60AP4
• Zfp464
• zinc finger protein 464 (RIP60)
• Zinc finger protein 464
• zinc finger protein AP4
• zinc finger proten AP4
• ZNF464

Background

REPIN1, also known as Replication initiator 1, is a 64kDa 567 amino acid protein that can be found in the nucleus. This gene is necessary for the process of initiating the chromosomal DNA replication. REPIN1 has been researched in relation to acrodermatitis enteropathica, enteropathica, acrodermatitis and immunodeficiency. REPIN1 has been linked to the synaptic transmission, cell proliferation, DNA replication, fatty acid transport and cell growth pathways where it interacts with GMNN, HDAC3, HDAC1, HDAC2 and GATA3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: REPIN1