REPIN1 Antibody

Images

 
Western Blot: REPIN1 Antibody [NBP2-85620] - WB Suggested Anti-REPIN1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

REPIN1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human REPIN1. Peptide sequence: GNCGRSFAQWDQLVAHKRVHVAEALEEAAAKALGPRPRGRPAVTAPRPGG The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
REPIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for REPIN1 Antibody

  • 60 kDa origin-specific DNA-binding protein
  • 60 kDa replication initiation region protein
  • ATT-binding protein
  • DHFR oribeta-binding protein RIP60
  • H_DJ0584D14.12
  • replication initiation region protein (60kD)
  • replication initiator 1
  • RIP60AP4
  • Zfp464
  • zinc finger protein 464 (RIP60)
  • Zinc finger protein 464
  • zinc finger protein AP4
  • zinc finger proten AP4
  • ZNF464

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-93944
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38961
Species: Hu
Applications: WB, IHC, IHC-P, KD
NB600-302
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Flow-IC
NBP1-90364
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56511
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA

Publications for REPIN1 Antibody (NBP2-85620) (0)

There are no publications for REPIN1 Antibody (NBP2-85620).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REPIN1 Antibody (NBP2-85620) (0)

There are no reviews for REPIN1 Antibody (NBP2-85620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REPIN1 Antibody (NBP2-85620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional REPIN1 Products

Bioinformatics Tool for REPIN1 Antibody (NBP2-85620)

Discover related pathways, diseases and genes to REPIN1 Antibody (NBP2-85620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REPIN1 Antibody (NBP2-85620)

Discover more about diseases related to REPIN1 Antibody (NBP2-85620).
 

Pathways for REPIN1 Antibody (NBP2-85620)

View related products by pathway.

PTMs for REPIN1 Antibody (NBP2-85620)

Learn more about PTMs related to REPIN1 Antibody (NBP2-85620).

Blogs on REPIN1

There are no specific blogs for REPIN1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our REPIN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol REPIN1