REPIN1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit REPIN1 Antibody - BSA Free (NBP2-85620) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human REPIN1. Peptide sequence: GNCGRSFAQWDQLVAHKRVHVAEALEEAAAKALGPRPRGRPAVTAPRPGG The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
REPIN1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for REPIN1 Antibody - BSA Free
Background
REPIN1, also known as Replication initiator 1, is a 64kDa 567 amino acid protein that can be found in the nucleus. This gene is necessary for the process of initiating the chromosomal DNA replication. REPIN1 has been researched in relation to acrodermatitis enteropathica, enteropathica, acrodermatitis and immunodeficiency. REPIN1 has been linked to the synaptic transmission, cell proliferation, DNA replication, fatty acid transport and cell growth pathways where it interacts with GMNN, HDAC3, HDAC1, HDAC2 and GATA3.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, Simple Western, WB
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu, Mu
Applications: WB
Publications for REPIN1 Antibody (NBP2-85620) (0)
There are no publications for REPIN1 Antibody (NBP2-85620).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for REPIN1 Antibody (NBP2-85620) (0)
There are no reviews for REPIN1 Antibody (NBP2-85620).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for REPIN1 Antibody (NBP2-85620) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional REPIN1 Products
Blogs on REPIN1