RELT/TNFRSF19L Antibody - BSA Free

Western Blot: RELT/TNFRSF19L Antibody [NBP2-56851] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: RELT/TNFRSF19L Antibody [NBP2-56851] - Staining of human cell line RH-30 shows localization to nucleus.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RELT/TNFRSF19L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RELT/TNFRSF19L Antibody - BSA Free (NBP2-56851) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-RELT/TNFRSF19L Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHIC
• Predicted Species: Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RELT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RELT/TNFRSF19L Recombinant Protein Antigen (NBP2-56851PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RELT/TNFRSF19L Antibody - BSA Free

• Receptor expressed in lymphoid tissues
• RELT tumor necrosis factor receptor
• RELT
• TNFRSF19L
• TNFRSF19LFLJ14993
• tumor necrosis factor receptor superfamily member 19L
• tumor necrosis factor receptor superfamily, member 19-like

Background

RELT is encoded by this gene is a member of the TNF-receptor superfamily. This receptor is especially abundant in hematologic tissues. It has been shown to activate the NF-kappaB pathway and selectively bind TNF receptor-associated factor 1 (TRAF1). This receptor is capable of stimulating T-cell proliferation in the presence of CD3 signaling, which suggests its regulatory role in immune response. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RELT/TNFRSF19L Antibody (NBP2-56851)(1)

Publication using NBP2-56851

• Robert SM, Reeves BC, Kiziltug E et al. The choroid plexus links innate immunity to CSF dysregulation in hydrocephalus Cell 2023-02-16 [PMID: 36803604]

Bioinformatics

• Gene Symbol: RELT