REEP1 Antibody

Images

 
Western Blot: REEP1 Antibody [NBP1-69643] - This Anti-REEP1 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.
Western Blot: REEP1 Antibody [NBP1-69643] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

REEP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to REEP1(receptor accessory protein 1) The peptide sequence was selected from the C terminal of REEP1. Peptide sequence ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
REEP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against REEP1 and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for REEP1 Antibody

  • C2orf23
  • chromosome 2 open reading frame 23
  • receptor accessory protein 1
  • receptor expression-enhancing protein 1
  • SPG31FLJ13110

Background

REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00051062-M03
Species: Hu, Rt
Applications: WB, ELISA
NBP1-59662
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59263
Species: Hu
Applications: WB, IHC
NBP2-45945
Species: Hu
Applications: WB, Flow, IHC
NBP1-59882
Species: Hu
Applications: WB, IHC
NBP1-82143
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7385
Species: Hu
Applications: WB, ICC
NBP2-20471
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-15615
Species: Hu
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-83512
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-89273
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88247
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69643
Species: Hu
Applications: WB

Publications for REEP1 Antibody (NBP1-69643) (0)

There are no publications for REEP1 Antibody (NBP1-69643).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REEP1 Antibody (NBP1-69643) (0)

There are no reviews for REEP1 Antibody (NBP1-69643). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REEP1 Antibody (NBP1-69643) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional REEP1 Products

Bioinformatics Tool for REEP1 Antibody (NBP1-69643)

Discover related pathways, diseases and genes to REEP1 Antibody (NBP1-69643). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REEP1 Antibody (NBP1-69643)

Discover more about diseases related to REEP1 Antibody (NBP1-69643).
 

Pathways for REEP1 Antibody (NBP1-69643)

View related products by pathway.

PTMs for REEP1 Antibody (NBP1-69643)

Learn more about PTMs related to REEP1 Antibody (NBP1-69643).

Blogs on REEP1

There are no specific blogs for REEP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our REEP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol REEP1
Uniprot