REEP1 Antibody


Western Blot: REEP1 Antibody [NBP1-62374] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

REEP1 Antibody Summary

Synthetic peptides corresponding to REEP1(receptor accessory protein 1) The peptide sequence was selected from the middle region of REEP1. Peptide sequence AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against REEP1 and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for REEP1 Antibody

  • C2orf23
  • chromosome 2 open reading frame 23
  • receptor accessory protein 1
  • receptor expression-enhancing protein 1
  • SPG31FLJ13110


REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
Species: Ha, Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IF, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for REEP1 Antibody (NBP1-62374) (0)

There are no publications for REEP1 Antibody (NBP1-62374).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REEP1 Antibody (NBP1-62374) (0)

There are no reviews for REEP1 Antibody (NBP1-62374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REEP1 Antibody (NBP1-62374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional REEP1 Products

Bioinformatics Tool for REEP1 Antibody (NBP1-62374)

Discover related pathways, diseases and genes to REEP1 Antibody (NBP1-62374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REEP1 Antibody (NBP1-62374)

Discover more about diseases related to REEP1 Antibody (NBP1-62374).

Pathways for REEP1 Antibody (NBP1-62374)

View related products by pathway.

PTMs for REEP1 Antibody (NBP1-62374)

Learn more about PTMs related to REEP1 Antibody (NBP1-62374).

Research Areas for REEP1 Antibody (NBP1-62374)

Find related products by research area.

Blogs on REEP1

There are no specific blogs for REEP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our REEP1 Antibody and receive a gift card or discount.


Gene Symbol REEP1