RED1 Antibody

Images

 
Western Blot: RED1 Antibody [NBP1-90240] - Analysis in human cell line U-251 MG.
Immunohistochemistry-Paraffin: RED1 Antibody [NBP1-90240] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Simple Western: RED1 Antibody [NBP1-90240] - Simple Western lane view shows a specific band for ADARB1 in 0.2 mg/ml of RT-4, U-251MG sp lysate. This experiment was performed under reducing conditions using the 12-230 ...read more
Simple Western: RED1 Antibody [NBP1-90240] - Simple Western lane view shows a specific band for ADARB1 in 0.2 mg/ml of U-251MG lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: RED1 Antibody [NBP1-90240] - Electropherogram image(s) of corresponding Simple Western lane view. RED1 antibody was used at 1:20 dilution on RT-4 lysates(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RED1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADARB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Theoretical MW
81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
RED1 Protein (NBP1-90240PEP)
Publications
Read Publication using NBP1-90240.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23534823)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RED1 Antibody

  • ADAR2a
  • ADAR2ADAR2g
  • ADAR2a-L1
  • ADAR2a-L2
  • ADAR2a-L3
  • ADAR2b
  • ADAR2c
  • adenosine deaminase, RNA-specific, B1
  • double-stranded RNA-specific editase 1
  • DRABA2
  • DRADA2hRED1
  • EC 3.5
  • human dsRNA adenosine deaminase DRADA2
  • human dsRNA adenosine deaminase DRADA2b, EC 3.510adenosine deaminase, RNA-specific, B1 (homolog of rat RED1)
  • RED1 homolog
  • RED1ADAR2d
  • RNA editase
  • RNA editing deaminase 1
  • RNA-editing deaminase 1
  • RNA-editing enzyme 1
  • RNA-specific, B1 (RED1 homolog rat)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-07321
Species: Hu
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90238
Species: Hu
Applications: IHC, IHC-P
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-02667
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58172
Species: Hu
Applications: WB
NB100-181
Species: Hu, Mu
Applications: WB, IP
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro

Publications for RED1 Antibody (NBP1-90240)(1)

Reviews for RED1 Antibody (NBP1-90240) (0)

There are no reviews for RED1 Antibody (NBP1-90240). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RED1 Antibody (NBP1-90240) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RED1 Products

Bioinformatics Tool for RED1 Antibody (NBP1-90240)

Discover related pathways, diseases and genes to RED1 Antibody (NBP1-90240). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RED1 Antibody (NBP1-90240)

Discover more about diseases related to RED1 Antibody (NBP1-90240).
 

Pathways for RED1 Antibody (NBP1-90240)

View related products by pathway.

Blogs on RED1

There are no specific blogs for RED1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RED1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADARB1
Entrez
Uniprot