Recoverin Antibody (4C6) - Azide and BSA Free Summary
                         
                                
                                
                                
            | Description | 
            Quality control test: Antibody Reactive Against Recombinant Protein.  | 
        
            | Immunogen | 
            RCV1 (NP_002894.1, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKN  | 
        
            | Specificity | 
            RCV1 (4C6)  | 
        
            | Isotype | 
            IgG2a Kappa  | 
        
            | Clonality | 
            Monoclonal  | 
        
            | Host | 
            Mouse  | 
        
            | Gene | 
            RCVRN  | 
        
            | Purity | 
            IgG purified  | 
        
            | Innovator's Reward | 
            Test in a species/application not listed above to receive a full credit towards a future purchase.  | 
        
                                
                          Applications/Dilutions
                                
                                    
                                    
                                        
                              
                                  | Dilutions | 
                                  
                                      - ELISA 
 - Sandwich ELISA 
 - Western Blot 1:500
 
                                       
                                   | 
                              
            | Application Notes | 
            Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.  | 
        
                                    
                                  Packaging, Storage & Formulations
            | Storage | 
            Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.  | 
        
            | Buffer | 
            In 1x PBS, pH 7.4  | 
        
            | Preservative | 
            No Preservative  | 
        
            | Purity | 
            IgG purified  | 
        
  Notes
                    
                        This product is produced by and distributed for Abnova, a company based in Taiwan.
                     Alternate Names for Recoverin Antibody (4C6) - Azide and BSA Free
                     Background
 
                    
                    This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy.
                      Limitations
 
                    
                    This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are 
guaranteed for 1 year from date of receipt.
 
                     Customers Who Viewed This Item Also Viewed...
                
                
                            
                                  
                                       Species: Hu
Applications: ICC/IF, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu, Pm
Applications: IHC, IHC-Fr,  IHC-P
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Hu
Applications: IHC, IP, WB
                                     
                                 
                             
                            
                                  
                                       
                                                
                                                Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
                                     
                                 
                              
                            
                                  
                                       
                                                
                                                Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                             
                            
                                  
                                       
                                                
                                                Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Mu
Applications: IHC, Simple Western, WB
                                     
                                 
                             
                            
                                  
                                       Species: Hu
Applications: IHC,  IHC-P, WB
                                     
                                 
                              
                            
                                  
                                       
                                                
                                                Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu
Applications: BA
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Mu, Rt
Applications: ICC/IF, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
                                     
                                 
                              
                            
                                  
                                       
                                                Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
                                     
                                 
                             
                            
                                  
                                       
                                                Species: Hu, Pm
Applications: IHC, IHC-Fr,  IHC-P
                                     
                                 
                              
                            
                                  
                                       
                                                
                                                Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
                                     
                                 
                             
                            
                                  
                                       Species: Hu
Applications: WB, ELISA
                                     
                                 
                              
                      
                  
            
                        
                        Publications for Recoverin Antibody (H00005957-M01) (0)
             
            
                        There are no publications for Recoverin Antibody (H00005957-M01).
                        By submitting your publication information earn gift cards and discounts for future purchases.
             
            
                        
                        Reviews for Recoverin Antibody (H00005957-M01) (0)	
                        
                        There are no reviews for Recoverin Antibody (H00005957-M01).
                        By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount. 
                            
                                - Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
 
                                - Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
 
                            
                                   
                  Product General Protocols
                        
                        Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
                        
Video Protocols
                        
                          FAQs for Recoverin Antibody (H00005957-M01) (0)
                        
                             
                  
                Secondary Antibodies
                    
                      |   | 
                Isotype Controls
                    
                     | 
Additional Recoverin Products
                            
                            Research Areas for Recoverin Antibody (H00005957-M01)
                    
                    Find related products by research area. 
                      | 
Blogs on Recoverin