RECK Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RECK Antibody [NBP2-57738] - Staining of human cell line ASC TERT1 shows localization to plasma membrane. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RECK Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IKPCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRPSTLGNIVEEVTHPC
Specificity
Specificity of human RECK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RECK
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RECK Antibody

  • hRECK
  • membrane-anchored glycoprotein (metastasis and invasion)
  • RECK
  • reversion-inducing-cysteine-rich protein with kazal motifs
  • ST15
  • ST15reversion-inducing cysteine-rich protein with Kazal motifs
  • suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich protein withkazal motifs)
  • suppression of tumorigenicity 5 (reversion-inducing-cysteine-rich protein withkazal motifs)
  • Suppressor of tumorigenicity 15 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-193
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, GP
Applications: WB, Simple Western, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67415
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF972
Species: Hu
Applications: WB, Simple Western, IHC, KO
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-46085
Species: Hu
Applications: WB, IHC
NB100-56519
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl
NBP2-57738
Species: Hu, Mu
Applications: ICC/IF

Publications for RECK Antibody (NBP2-57738) (0)

There are no publications for RECK Antibody (NBP2-57738).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RECK Antibody (NBP2-57738) (0)

There are no reviews for RECK Antibody (NBP2-57738). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RECK Antibody (NBP2-57738) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RECK Products

Bioinformatics Tool for RECK Antibody (NBP2-57738)

Discover related pathways, diseases and genes to RECK Antibody (NBP2-57738). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RECK Antibody (NBP2-57738)

Discover more about diseases related to RECK Antibody (NBP2-57738).
 

Pathways for RECK Antibody (NBP2-57738)

View related products by pathway.

PTMs for RECK Antibody (NBP2-57738)

Learn more about PTMs related to RECK Antibody (NBP2-57738).
 

Research Areas for RECK Antibody (NBP2-57738)

Find related products by research area.

Blogs on RECK

There are no specific blogs for RECK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RECK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RECK