RDM1 Recombinant Protein Antigen

Images

 
There are currently no images for RDM1 Recombinant Protein Antigen (NBP2-62656PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RDM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RDM1.

Source: E.coli

Amino Acid Sequence: AELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RDM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-62656. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RDM1 Recombinant Protein Antigen

  • MGC33977
  • RAD52 homolog B (S. cerevisiae)
  • RAD52 homolog B
  • RAD52 motif 1
  • RAD52 motif-containing protein 1
  • RAD52B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60017
Species: Mu, Rt, Bv(-), Ca(-), Hu(-), Po(-), Rb(-), Sh(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-FrFl
NBP1-87372
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-58116
Species: Hu
Applications: ICC/IF
NBP2-57022
Species: Hu
Applications: WB, ICC/IF
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
MAB6817
Species: Hu
Applications: WB
H00003090-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-41185
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NB100-894
Species: Hu
Applications: WB, Flow, ICC/IF, PEP-ELISA
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00006603-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-89156
Species: Hu
Applications: IHC, IHC-P
NBP1-77146
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-62656PEP
Species: Hu
Applications: AC

Publications for RDM1 Recombinant Protein Antigen (NBP2-62656PEP) (0)

There are no publications for RDM1 Recombinant Protein Antigen (NBP2-62656PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RDM1 Recombinant Protein Antigen (NBP2-62656PEP) (0)

There are no reviews for RDM1 Recombinant Protein Antigen (NBP2-62656PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RDM1 Recombinant Protein Antigen (NBP2-62656PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional RDM1 Products

Bioinformatics Tool for RDM1 Recombinant Protein Antigen (NBP2-62656PEP)

Discover related pathways, diseases and genes to RDM1 Recombinant Protein Antigen (NBP2-62656PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RDM1 Recombinant Protein Antigen (NBP2-62656PEP)

Discover more about diseases related to RDM1 Recombinant Protein Antigen (NBP2-62656PEP).
 

Pathways for RDM1 Recombinant Protein Antigen (NBP2-62656PEP)

View related products by pathway.

PTMs for RDM1 Recombinant Protein Antigen (NBP2-62656PEP)

Learn more about PTMs related to RDM1 Recombinant Protein Antigen (NBP2-62656PEP).

Blogs on RDM1

There are no specific blogs for RDM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NK1R Antibody
NB300-119

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RDM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RDM1