RCBTB2 Antibody (4G12)

Images

 
Sandwich ELISA: RCBTB2 Antibody (4G12) [H00001102-M06] - Detection limit for recombinant GST tagged RCBTB2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
4G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RCBTB2 Antibody (4G12) Summary

Immunogen
RCBTB2 (NP_001259, 86 a.a. - 194 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPI
Specificity
RCBTB2 - regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2 (4G12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RCBTB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RCBTB2 Antibody (4G12)

  • CHC1-L
  • CHC1LRCC1-like G exchanging factor RLG
  • Chromosome condensation 1-like
  • RCC1 and BTB domain-containing protein 2
  • RCC1-like G exchanging factor
  • regulator of chromosome condensation (RCC1) and BTB (POZ) domain containingprotein 2
  • regulator of chromosome condensation and BTB domain containing protein 2
  • Regulator of chromosome condensation and BTB domain-containing protein 2
  • RLG

Background

This gene encodes a member of the RCC1-related GEF family. The N-terminal half of the encoded amino acid sequence shows similarity to the regulator of chromosome condensation RCC1, which acts as a guanine nucleotide exchange factor (GEF) protein for the Ras-related GTPase Ran. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-85637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-24945
Species: Hu, Mu, Rt, Po, Ca, Pm
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88354
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14197
Species: Hu
Applications: IHC, IHC-P
NB100-56659
Species: Hu, Mu, Rt
Applications: WB
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5089
Species: Hu
Applications: WB, IHC
NBP1-88809
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RCBTB2 Antibody (H00001102-M06) (0)

There are no publications for RCBTB2 Antibody (H00001102-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCBTB2 Antibody (H00001102-M06) (0)

There are no reviews for RCBTB2 Antibody (H00001102-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RCBTB2 Antibody (H00001102-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RCBTB2 Products

Bioinformatics Tool for RCBTB2 Antibody (H00001102-M06)

Discover related pathways, diseases and genes to RCBTB2 Antibody (H00001102-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCBTB2 Antibody (H00001102-M06)

Discover more about diseases related to RCBTB2 Antibody (H00001102-M06).
 

Pathways for RCBTB2 Antibody (H00001102-M06)

View related products by pathway.

Blogs on RCBTB2

There are no specific blogs for RCBTB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCBTB2 Antibody (4G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol RCBTB2
Entrez
Uniprot