RCBTB1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit RCBTB1 Antibody - BSA Free (NBP2-58358) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RCBTB1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for RCBTB1 Antibody - BSA Free
Background
Residing in the cytoplasm and nucleus, RCBTB1 is involved in cell cycle regulation by chromatin remodeling. More specifically, RCBTB1 encodes a protein with an N-terminal RCC1 domain and a C-terminal BTB domain. This gene interacts with MAP1LC3B, ATG16L1, CLN3, FYCO1 and GABARAP. Mapping to chromosome 13q in humans, this gene is commonly deleted in B-cell chronic lymphocytic leukemia and other lymphoid malignancies. Common diseases associated with RCBTB1 include alcoholism, asthma, hypertrophy and chronic lymphocytic leukemia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Mu
Applications: WB
Publications for RCBTB1 Antibody (NBP2-58358) (0)
There are no publications for RCBTB1 Antibody (NBP2-58358).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RCBTB1 Antibody (NBP2-58358) (0)
There are no reviews for RCBTB1 Antibody (NBP2-58358).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RCBTB1 Antibody (NBP2-58358) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RCBTB1 Products
Blogs on RCBTB1