RCAN2 Antibody

Western Blot: RCAN2 Antibody [H00010231-B01P] - Analysis of RCAN2 expression in transfected 293T cell line by RCAN2 polyclonal antibody. Lane 1: DSCR1L1 transfected lysate(24.75 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated

RCAN2 Antibody Summary

• Immunogen: RCAN2 (AAH38509.1, 1 a.a. - 225 a.a.) full-length human protein. MPAPSMDCDVSTLVACVVDVEVFTNQEVKEKFEGLFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAACSFSIIAVSSLSCFFPLLFVKKNCL
• Specificity: RCAN2 - regulator of calcineurin 2,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: RCAN2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 25450864)

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RCAN2 Antibody

• Calcipressin 2 (Thyroid hormone-responsive protein ZAKI-4) (Down syndromecandidate region 1-like 1) (Myocyte-enriched calcineurin interacting protein2) (MCIP2)
• calcipressin-2
• Down syndrome candidate region 1-like 1
• Down syndrome critical region gene 1-like 1
• DSCR1L1MCIP2ZAKI4RCN2
• hRCN2
• Myocyte-enriched calcineurin-interacting protein 2
• regulator of calcineurin 2CSP2
• thyroid hormone-responsive (skin fibroblasts)
• Thyroid hormone-responsive protein ZAKI-4
• ZAKI-4

Background

Calcipressin-2, also known as RCAN2, plays a key role in many physiological procedures. Expressed in fibroblasts, heart, brain, liver, and skeletal muscle, RCAN2 prevents calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Translocation of the transcription factor NFATC1 can also be attributed to the binding of calcineurin A. Further research indicates that RCAN could also play a role in endothelial cell function, angiogenesis and central nervous system development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RCAN2 Antibody (H00010231-B01P)(1)

Publication using H00010231-B01P

• Qin W, Pan J, Wu Y et al. Anabolic steroids activate calcineurin-nFAT signaling and thereby increase myotube size and reduce denervation atrophy. Mol. Cell. Endocrinol. 2014-10-29 [PMID: 25450864] (WB, Rat)

Bioinformatics

• Gene Symbol: RCAN2
• Entrez:
  • 10231(Human)
• Uniprot:
  • AAH38509.1(Human)