RBPSUHL Antibody

Images

 
Western Blot: RBPSUHL Antibody [NBP2-84239] - WB Suggested Anti-RBPJL Antibody Titration: 2.5ug/ml. Positive Control: Jurkat cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBPSUHL Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RBPSUHL. Peptide sequence: AHQAGETGPTVCGYMGLDSASGSATETQKLNFEQQPDSREFGCAKTLYIS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RBPJL
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for RBPSUHL Antibody

  • RBPL
  • RBP-L
  • RBPSUHL
  • recombination signal binding protein for immunoglobulin kappa J region-like
  • recombining binding protein suppressor of hairless (Drosophila)-like
  • recombining binding protein suppressor of hairless-like protein
  • SUH
  • SUHL
  • Transcription factor RBP-L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33427
Species: Hu
Applications: WB, ICC/IF, ChIP
NB100-60953
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP2-74045
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-77012
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
NBP2-16991
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-47427
Species: Hu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-71805
Species: Hu
Applications: WB, IP
NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-19613
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-82465
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-84239
Species: Hu
Applications: WB

Publications for RBPSUHL Antibody (NBP2-84239) (0)

There are no publications for RBPSUHL Antibody (NBP2-84239).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBPSUHL Antibody (NBP2-84239) (0)

There are no reviews for RBPSUHL Antibody (NBP2-84239). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBPSUHL Antibody (NBP2-84239) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RBPSUHL Products

Bioinformatics Tool for RBPSUHL Antibody (NBP2-84239)

Discover related pathways, diseases and genes to RBPSUHL Antibody (NBP2-84239). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBPSUHL Antibody (NBP2-84239)

Discover more about diseases related to RBPSUHL Antibody (NBP2-84239).
 

Pathways for RBPSUHL Antibody (NBP2-84239)

View related products by pathway.

Blogs on RBPSUHL

There are no specific blogs for RBPSUHL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBPSUHL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBPJL