RBMY1A1 Antibody


Western Blot: RBMY1A1 Antibody [NBP1-57363] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

RBMY1A1 Antibody Summary

Synthetic peptides corresponding to RBMY1A1(RNA binding motif protein, Y-linked, family 1, member A1) The peptide sequence was selected from the N terminal of RBMY1A1. Peptide sequence MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RBMY1A1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RBMY1A1 Antibody

  • MGC181956
  • RBM
  • RBM1
  • RBM2
  • RBMY
  • RBMY1C
  • RNA binding motif protein, Y chromosome, family 1, member A1
  • RNA binding motif protein, Y-linked, family 1, member A1
  • RNA binding protein
  • RNA-binding motif protein 1
  • RNA-binding motif protein 2
  • RNA-binding motif protein, Y chromosome, family 1 member A1/C
  • y chromosome RNA recognition motif 1
  • YRRM1
  • YRRM2


RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RBMY1A1 Antibody (NBP1-57363) (0)

There are no publications for RBMY1A1 Antibody (NBP1-57363).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBMY1A1 Antibody (NBP1-57363) (0)

There are no reviews for RBMY1A1 Antibody (NBP1-57363). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBMY1A1 Antibody (NBP1-57363) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RBMY1A1 Products

Bioinformatics Tool for RBMY1A1 Antibody (NBP1-57363)

Discover related pathways, diseases and genes to RBMY1A1 Antibody (NBP1-57363). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBMY1A1 Antibody (NBP1-57363)

Discover more about diseases related to RBMY1A1 Antibody (NBP1-57363).

Pathways for RBMY1A1 Antibody (NBP1-57363)

View related products by pathway.

PTMs for RBMY1A1 Antibody (NBP1-57363)

Learn more about PTMs related to RBMY1A1 Antibody (NBP1-57363).

Blogs on RBMY1A1

There are no specific blogs for RBMY1A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RBMY1A1 Antibody and receive a gift card or discount.


Gene Symbol RBMY1A1