RBMY1A1 Antibody

Images

 
Western Blot: RBMY1A1 Antibody [NBP1-57363] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBMY1A1 Antibody Summary

Immunogen
Synthetic peptides corresponding to RBMY1A1(RNA binding motif protein, Y-linked, family 1, member A1) The peptide sequence was selected from the N terminal of RBMY1A1. Peptide sequence MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBMY1A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RBMY1A1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RBMY1A1 Antibody

  • MGC181956
  • RBM
  • RBM1
  • RBM2
  • RBMY
  • RBMY1C
  • RNA binding motif protein, Y chromosome, family 1, member A1
  • RNA binding motif protein, Y-linked, family 1, member A1
  • RNA binding protein
  • RNA-binding motif protein 1
  • RNA-binding motif protein 2
  • RNA-binding motif protein, Y chromosome, family 1 member A1/C
  • y chromosome RNA recognition motif 1
  • YRRM1
  • YRRM2

Background

RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-41198
Species: Hu, Mu
Applications: WB, ELISA
NBP2-34152
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008653-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
H00027288-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-79749
Species: Hu
Applications: WB
NB100-2437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-55967
Species: Hu
Applications: ICC/IF
NBP1-98290
Species: Hu
Applications: WB
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
22240002
Species: Hu
Applications: WB, ELISA
H00159119-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-49399
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RBMY1A1 Antibody (NBP1-57363) (0)

There are no publications for RBMY1A1 Antibody (NBP1-57363).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBMY1A1 Antibody (NBP1-57363) (0)

There are no reviews for RBMY1A1 Antibody (NBP1-57363). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBMY1A1 Antibody (NBP1-57363) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBMY1A1 Products

Bioinformatics Tool for RBMY1A1 Antibody (NBP1-57363)

Discover related pathways, diseases and genes to RBMY1A1 Antibody (NBP1-57363). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBMY1A1 Antibody (NBP1-57363)

Discover more about diseases related to RBMY1A1 Antibody (NBP1-57363).
 

Pathways for RBMY1A1 Antibody (NBP1-57363)

View related products by pathway.

PTMs for RBMY1A1 Antibody (NBP1-57363)

Learn more about PTMs related to RBMY1A1 Antibody (NBP1-57363).

Blogs on RBMY1A1

There are no specific blogs for RBMY1A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBMY1A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBMY1A1
Uniprot