RBM27 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RBM27 Antibody [NBP1-90817] - Staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: RBM27 Antibody [NBP1-90817] - Staining of human duodenum shows strong nuclear and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM27 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YTKNYLPLLEPVKPEPKPLVQEKEEIKEEVFQEPAEEERDGRKKKYPSPQKTRSESSERRTREKKREDGKWRDYDRYYERNELYREK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM27
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM27 Protein (NBP1-90817PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM27 Antibody

  • RNA-binding protein 27
  • ARRS1
  • Psc1
  • RNA binding motif protein 27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF-237-NA
Species: Hu
Applications: WB, IHC, Neut
AF4885
Species: Mu
Applications: WB, IP
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-49536
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-84863
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5726
Species: Hu
Applications: WB
NBP2-37357
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-91979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34951
Species: Hu
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-03348
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for RBM27 Antibody (NBP1-90817) (0)

There are no publications for RBM27 Antibody (NBP1-90817).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM27 Antibody (NBP1-90817) (0)

There are no reviews for RBM27 Antibody (NBP1-90817). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RBM27 Antibody (NBP1-90817) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM27 Products

Bioinformatics Tool for RBM27 Antibody (NBP1-90817)

Discover related pathways, diseases and genes to RBM27 Antibody (NBP1-90817). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RBM27 Antibody (NBP1-90817)

View related products by pathway.

PTMs for RBM27 Antibody (NBP1-90817)

Learn more about PTMs related to RBM27 Antibody (NBP1-90817).

Blogs on RBM27

There are no specific blogs for RBM27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM27
Entrez