RBM10 Antibody

Images

 
Western Blot: RBM10 Antibody [NBP1-84951] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-RBM10 antibody. Remaining relative intensity is presented. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: RBM10 Antibody [NBP1-84951] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: RBM10 Antibody [NBP1-84951] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: RBM10 Antibody [NBP1-84951] - Staining of human cerebellum shows moderate to strong nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: RBM10 Antibody [NBP1-84951] - Staining of human prostate shows moderate to strong nuclear positivity.
Immunohistochemistry-Paraffin: RBM10 Antibody [NBP1-84951] - Staining of human small intestine shows moderate to strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDSSEEQSAEDSYEASPGSETQRR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM10 Protein (NBP1-84951PEP)
Publications
Read Publication using
NBP1-84951 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25586139).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM10 Antibody

  • DXS8237ERNA-binding motif protein 10
  • G patch domain-containing protein 9
  • GPATC9TARPS
  • GPATCH9MGC1132
  • KIAA0122RNA-binding protein S1-1
  • MGC997
  • RNA binding motif protein 10
  • RNA-binding protein 10
  • S1-1
  • ZRANB5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81580
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89376
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-34152
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-55990
Species: Hu
Applications: WB, ICC/IF
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RBM10 Antibody (NBP1-84951)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for RBM10 Antibody (NBP1-84951) (0)

There are no reviews for RBM10 Antibody (NBP1-84951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM10 Antibody (NBP1-84951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM10 Products

Bioinformatics Tool for RBM10 Antibody (NBP1-84951)

Discover related pathways, diseases and genes to RBM10 Antibody (NBP1-84951). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM10 Antibody (NBP1-84951)

Discover more about diseases related to RBM10 Antibody (NBP1-84951).
 

Pathways for RBM10 Antibody (NBP1-84951)

View related products by pathway.

PTMs for RBM10 Antibody (NBP1-84951)

Learn more about PTMs related to RBM10 Antibody (NBP1-84951).

Blogs on RBM10

There are no specific blogs for RBM10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM10