RbAp46 Antibody - Azide and BSA Free

Western Blot: RbAp46 Antibody [NBP2-94894] - Western blot analysis of extracts of various cell lines, using RbAp46 antibody (NBP2-94894) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Chromatin Immunoprecipitation: RbAp46 Antibody [NBP2-94894] - Analysis of extracts of 293T cells, using RbAp46 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Western Blot: RbAp46 Antibody [NBP2-94894] - Western blot analysis of extracts of Rat spleen, using RbAp46 antibody (NBP2-94894) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunohistochemistry-Paraffin-RbAp46 Antibody-NBP2-94894- Rat lung using RbAp46/RBBP7 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RbAp46 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human RbAp46 (NP_002884.1). MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBBP7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 1:50-1:200
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:100 - 1:500

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for RbAp46 Antibody - Azide and BSA Free

• G1/S transition control protein-binding protein RbAp46
• Histone acetyltransferase type B subunit 2
• histone-binding protein RBBP7
• MGC138867
• Nucleosome-remodeling factor subunit RBAP46
• RbAp46
• RBBP-7
• retinoblastoma binding protein 7
• Retinoblastoma-binding protein 7MGC138868
• Retinoblastoma-binding protein p46
• retinoblastoma-binding protein RbAp46

Background

RBBP7 antibody, also known as RbAp46 (Retinoblastoma protein associated protein 46), is a nuclear protein that has been shown to interact directly with retinoblastoma protein and is a component of the mSin3 corepressor complex, as are the histone deacetylase proteins (HDACs). It shares about 75% sequence identity with the closely related RbAp48, and appears to be functionally related to the yeast MSI1 protein in that overexpression of RbAp46 suppresses heat shock sensitivity in a RAS pathway dependent manner. RBBP7 has also been demonstrated to be up-regulated by the Wilms' tumor suppressor gene product, WT1. In addition, cells transfected with this antibody have shown strong inhibition of growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBBP7