RASL11B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RASL11B Antibody [NBP2-31695] - Staining of human cell line CACO-2 shows localization to nuclear bodies.
Immunohistochemistry-Paraffin: RASL11B Antibody [NBP2-31695] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASL11B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASL11B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RASL11B Protein (NBP2-31695PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RASL11B Antibody

  • MGC2827
  • MGC4499
  • ras-like protein family member 11B
  • RAS-like, family 11, member B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32719
Species: Hu
Applications: WB, ICC/IF
NBP2-58844
Species: Hu
Applications: ICC/IF
NBP1-81925
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1062
Species: Mu
Applications: WB, IHC, Neut
NBP2-30368
Species: Hu
Applications: WB, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00010265-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-85064
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-82545
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB8570
Species: Hu
Applications: Flow, CyTOF-ready
AF1334
Species: Hu
Applications: WB, IHC
AF2320
Species: Hu
Applications: WB, Block
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-31695
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RASL11B Antibody (NBP2-31695) (0)

There are no publications for RASL11B Antibody (NBP2-31695).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASL11B Antibody (NBP2-31695) (0)

There are no reviews for RASL11B Antibody (NBP2-31695). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RASL11B Antibody (NBP2-31695) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASL11B Products

Bioinformatics Tool for RASL11B Antibody (NBP2-31695)

Discover related pathways, diseases and genes to RASL11B Antibody (NBP2-31695). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASL11B Antibody (NBP2-31695)

Discover more about diseases related to RASL11B Antibody (NBP2-31695).
 

Pathways for RASL11B Antibody (NBP2-31695)

View related products by pathway.

PTMs for RASL11B Antibody (NBP2-31695)

Learn more about PTMs related to RASL11B Antibody (NBP2-31695).
 

Research Areas for RASL11B Antibody (NBP2-31695)

Find related products by research area.

Blogs on RASL11B

There are no specific blogs for RASL11B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASL11B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASL11B
Uniprot