RASL11B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RASL11B Antibody [NBP2-31695] - Staining of human cell line CACO-2 shows localization to nuclear bodies. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RASL11B Antibody [NBP2-31695] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human liver shows weak cytoplasmic positivity in hepatocytes.

Staining of human testis shows weak cytoplasmic positivity in subset of cells in seminiferous ducts.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RASL11B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RASL11B Antibody - BSA Free (NBP2-31695) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQ
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASL11B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RASL11B Protein (NBP2-31695PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RASL11B Antibody - BSA Free

• MGC2827
• MGC4499
• ras-like protein family member 11B
• RAS-like, family 11, member B

Background

RASL11B (RAS-Like, Family 11, Member B) belongs to the small GTPase protein family and may have a role in TGF-beta1-mediated developmental processes. RASL11B is known to have interactions with EWSR1 and has been studied in relation to prostatitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RASL11B
• Uniprot:
  • Q9BPW5(Human)