Recombinant Human RASGRF1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RASGRF1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human RASGRF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RASGRF1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RASGRF1 Protein

  • CDC25guanine nucleotide exchange factor
  • CDC25L
  • GNRPguanine nucleotide-releasing factor 1
  • GRF1
  • GRF55
  • guanine nucleotide-releasing factor, 55 kD
  • Guanine nucleotide-releasing protein
  • H-GRF55
  • PP13187
  • Ras protein-specific guanine nucleotide-releasing factor 1
  • ras-GRF1
  • ras-specific guanine nucleotide-releasing factor 1
  • Ras-specific guanine nucleotide-releasing factor, CDC25 homolog
  • Ras-specific nucleotide exchange factor CDC25

Background

RASGRF1 - Ras protein-specific guanine nucleotide-releasing factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF

Publications for RASGRF1 Partial Recombinant Protein (H00005923-Q01) (0)

There are no publications for RASGRF1 Partial Recombinant Protein (H00005923-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASGRF1 Partial Recombinant Protein (H00005923-Q01) (0)

There are no reviews for RASGRF1 Partial Recombinant Protein (H00005923-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RASGRF1 Partial Recombinant Protein (H00005923-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RASGRF1 Products

RASGRF1 H00005923-Q01

Bioinformatics Tool for RASGRF1 Partial Recombinant Protein (H00005923-Q01)

Discover related pathways, diseases and genes to RASGRF1 Partial Recombinant Protein (H00005923-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASGRF1 Partial Recombinant Protein (H00005923-Q01)

Discover more about diseases related to RASGRF1 Partial Recombinant Protein (H00005923-Q01).
 

Pathways for RASGRF1 Partial Recombinant Protein (H00005923-Q01)

View related products by pathway.

PTMs for RASGRF1 Partial Recombinant Protein (H00005923-Q01)

Learn more about PTMs related to RASGRF1 Partial Recombinant Protein (H00005923-Q01).
 

Research Areas for RASGRF1 Partial Recombinant Protein (H00005923-Q01)

Find related products by research area.

Blogs on RASGRF1

There are no specific blogs for RASGRF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RASGRF1 Antibody
NBP1-85727

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RASGRF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RASGRF1