RASA4 Antibody

Images

 
Western Blot: RASA4 Antibody [NBP2-13203] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: RASA4 Antibody [NBP2-13203] - Staining of human kidney shows strong cytoplasmic and membranous positivity in a subset of renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASA4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSSSFKKLYFSLTTEALSFAKTPSSKKSALIKLANIRAAEKVEEKSFGGS HVMQVIYTDDAGRPQTAYLQCKC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RASA4 Protein (NBP2-13203PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RASA4 Antibody

  • Ca2+-promoted Ras inactivator
  • Calcium-promoted Ras inactivator
  • CAPRIGAPLKIAA0538RASA4B
  • FLJ59070
  • Putative Ras GTPase-activating protein 4B
  • ras GTPase-activating protein 4
  • RAS p21 protein activator 4MGC131890
  • RasGAP-activating-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-32776
Species: Hu
Applications: WB, ICC/IF
NBP2-20081
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83002
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF5094
Species: Hu, Mu, Rt
Applications: WB
AF1936
Species: Hu
Applications: WB, IP
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-94105
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-13203
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RASA4 Antibody (NBP2-13203) (0)

There are no publications for RASA4 Antibody (NBP2-13203).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASA4 Antibody (NBP2-13203) (0)

There are no reviews for RASA4 Antibody (NBP2-13203). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RASA4 Antibody (NBP2-13203) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASA4 Products

RASA4 NBP2-13203

Bioinformatics Tool for RASA4 Antibody (NBP2-13203)

Discover related pathways, diseases and genes to RASA4 Antibody (NBP2-13203). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASA4 Antibody (NBP2-13203)

Discover more about diseases related to RASA4 Antibody (NBP2-13203).
 

Pathways for RASA4 Antibody (NBP2-13203)

View related products by pathway.

PTMs for RASA4 Antibody (NBP2-13203)

Learn more about PTMs related to RASA4 Antibody (NBP2-13203).

Blogs on RASA4

There are no specific blogs for RASA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASA4
Entrez