RAP6 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

RAP6 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GAPVD1.
  
  

  Source: E. coli

  Amino Acid Sequence: AMTGSEEGDPRTKSSLGKFDKSCVAAFLDVVIGGRAVETPPLSSVNLLEGLSRTVVYITYSQLITLVNFMKSVMSGDQLREDRMALDNLLANLP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GAPVD1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85136.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RAP6 Recombinant Protein Antigen

• DKFZP434C212
• GAPex-5
• GAPEX5RAP6Rab5-activating protein 6
• GTPase activating protein and VPS9 domains 1
• GTPase-activating protein and VPS9 domain-containing protein 1
• KIAA1521MGC138848
• MGC138847

Background

GAPex-5 was identified in a two-hybrid screen for interactors of CIP4 (Cdc42 interacting protein 4). GAPex-5 contains a Ras-GAP domain and a VPS9 (vacuolar sorting protein 9 (VPS9) domain. It functions as a GEF for RAB31 to influence GLUT4 trafficking. It has also been found to be involved in the trafficking and ubiquitination of EGFR. Alternate names for GAPex-5 include GTPase-activating protein and VPS9 domain-containing protein 1, Rab5-activating protein 6, GAPVD1, GAPEX5, RAP6, and KIAA1521.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GAPVD1