We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RAP6 Recombinant Protein Antigen

Images

 
There are currently no images for RAP6 Protein (NBP1-85136PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RAP6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GAPVD1.

Source: E. coli

Amino Acid Sequence: AMTGSEEGDPRTKSSLGKFDKSCVAAFLDVVIGGRAVETPPLSSVNLLEGLSRTVVYITYSQLITLVNFMKSVMSGDQLREDRMALDNLLANLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GAPVD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85136.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RAP6 Recombinant Protein Antigen

  • DKFZp434C212
  • GAPex-5
  • GAPEX5RAP6Rab5-activating protein 6
  • GTPase activating protein and VPS9 domains 1
  • GTPase-activating protein and VPS9 domain-containing protein 1
  • KIAA1521MGC138848
  • MGC138847

Background

GAPex-5 was identified in a two-hybrid screen for interactors of CIP4 (Cdc42 interacting protein 4). GAPex-5 contains a Ras-GAP domain and a VPS9 (vacuolar sorting protein 9 (VPS9) domain. It functions as a GEF for RAB31 to influence GLUT4 trafficking. It has also been found to be involved in the trafficking and ubiquitination of EGFR. Alternate names for GAPex-5 include GTPase-activating protein and VPS9 domain-containing protein 1, Rab5-activating protein 6, GAPVD1, GAPEX5, RAP6, and KIAA1521.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, IP, WB
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB6210
Species: Hu
Applications: Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP3-38370
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP3-15915
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NB100-82001
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-62573
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
2914-HT
Species: Hu
Applications: BA
NBP2-87002
Species: Hu
Applications: WB

Publications for RAP6 Protein (NBP1-85136PEP) (0)

There are no publications for RAP6 Protein (NBP1-85136PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAP6 Protein (NBP1-85136PEP) (0)

There are no reviews for RAP6 Protein (NBP1-85136PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RAP6 Protein (NBP1-85136PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAP6 Products

Array NBP1-85136PEP

Blogs on RAP6

There are no specific blogs for RAP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RAP6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GAPVD1